KEGG   Phenylobacterium zucineum: PHZ_c2050Help
Entry
PHZ_c2050         CDS       T00750                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
pzu  Phenylobacterium zucineum
Brite
Enzymes [BR:pzu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     PHZ_c2050
Lipid biosynthesis proteins [BR:pzu01004]
 Acyl-CoA synthetase
  Unknown
   PHZ_c2050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2291990..2293681
Genome map
AA seq 563 aa AA seqDB search
MTPTPTAPDRPFRLGGFATLTEALDFAAQGPTGVNLYGLRGELVLALSYAELRERARALA
ARILAAGIRPFDRVGLVAETDADFVVAFFACQHARVTPAPLGGREAYVEQIGRMLGSAQA
SAVFGPEALIPWLQEAAQAAGVRLAARVQDLPEAPAADLPAPTPDDPCYVQFSSGSTRHP
TGVLCTHSALMANTTAITRDGLKVVPADRAFSWLPLYHDMGLVGFLMAPLASQMTVDLMP
TGAFVRRPLLWLDLMSKNRATISYSPTFGYELCARRGDGTREGLDLSAWRIAGCGGDMVR
PGPLMAFAETFAPAGFSPTAFVASYGMAEATLALTMAPLGQGLRFETVDVDRMERDGVVV
GGREGRSRAFVRCGPVLPGHELEVRDEAGAALPELKVGRVFVRGPSLMRGYFGEPEASAK
VLGPDGWLDTGDLGFLVEGEIVPTGRAKDLILLNGRNVWPQDLEWSAESEIGKLRSGDVA
AFSVDRDEGEQLVVLVQARTSDPEARRALADDVAALLRARHGVEAHVELVGAHALPQTSS
GKLSRSKAKALYLAGAFRAEEPA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
ttgacccctacccccaccgctcccgaccggcccttccgactgggcgggttcgccaccctg
accgaggcgctggacttcgccgcccaggggcccacgggcgtgaacctctacggcctgcgc
ggcgagctggtgctcgccctgtcctacgccgagctgcgcgagcgggcccgcgccctggcc
gcgcgcatcctggcggccgggatccggccgttcgaccgcgtgggcctcgtcgccgagacc
gacgccgacttcgtggtcgccttcttcgcctgccagcacgcccgggtgacgcccgcgccg
ctgggcggccgcgaggcctatgtggagcagatcggccggatgctgggctcggcgcaggcc
tcggccgtgttcggccccgaggccctgatcccgtggctgcaggaggcggcgcaggccgcc
ggcgtgaggctcgcggcccgcgtccaggacctgcccgaggcgcccgccgccgacctgccc
gcgccgacgccggacgatccctgctacgtgcagttctcctcgggcagcacgcggcacccg
acgggcgtcctctgcacccacagcgccttgatggccaacaccaccgcgatcacccgcgac
gggctgaaggtggtcccggccgaccgggcgttctcgtggctgccgctctatcacgacatg
ggcctggtgggcttcctgatggccccgctggccagccagatgaccgtggacctgatgccc
acgggcgccttcgtgcgccggccgctgctgtggctggacctgatgtcgaagaaccgggcg
acgatctcgtacagcccgaccttcggctacgagctgtgcgcccgccgcggcgacggcacg
cgcgaggggctggacctgtcggcctggcggatcgccggctgcggcggcgacatggtgcgg
ccgggcccgctgatggccttcgccgagacgttcgcgcccgccggcttctcccccacggcc
ttcgtcgccagctacggcatggccgaggcgacgctggcgctgaccatggcgccgctgggc
cagggactgcggttcgagaccgtcgacgtcgaccggatggagcgcgacggcgtggtcgtc
ggcggccgggaaggccgcagccgggccttcgtccgctgcgggccggtgctgcccggccac
gagctggaggtccgcgacgaggcgggcgccgccctgcccgagctgaaggtcggccgggtg
ttcgtgcggggccccagcctgatgcgcggctatttcggcgagcccgaggcctcggccaag
gtgctggggccggacggctggctcgacaccggcgacctgggcttcctggtcgagggcgag
atcgtgccgacgggccgcgccaaggacctgatcctgctgaacggccggaacgtctggccg
caggacctggaatggtccgccgagagcgagatcggcaagctgcgcagcggcgacgtggcc
gcgttctcggtcgaccgcgacgagggcgagcagctggtcgtgctggtgcaggcgcgcacc
agcgatcccgaggcgcgccgggcgctggccgacgacgtcgccgccctgctccgggcccgg
cacggcgtggaggcccacgtggagctggtgggggcgcacgccctgccgcagacctcgtcg
ggcaagctcagccggtccaaggccaaggcgctgtacctggcgggcgccttccgggcggag
gagccggcctga

DBGET integrated database retrieval system