KEGG   Phenylobacterium zucineum: PHZ_c3259Help
Entry
PHZ_c3259         CDS       T00750                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PHZ_c3259
Enzymes [BR:pzu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PHZ_c3259
DNA repair and recombination proteins [BR:pzu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PHZ_c3259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M Crp
Motif
Other DBs
NCBI-ProteinID: ACG79668
UniProt: B4RAS0
LinkDB All DBs
Position
3695109..3697772
Genome map
AA seq 887 aa AA seqDB search
MADKLARYRAMRDFSKTAEPAGAEKTKASRRLRFVIQKHAATRLHYDFRLELDGVFLSWA
VTKGPSLNPADRRLAVQTEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGDARAML
KKGDLKFTLDGERLKGSWVLVRMKRREREKRDNWLLIKHHDGWSVEDHGEFLVEGETSSV
ASGRAMDEIEAGKGKGPTKFMTGKGRASGKDVWQSNRADPKAPPPAAEKAAPAPKLKAAA
LPGFVAPQLAKSVDRPPQGAGWGHEIKFDGYRLQLRVENGKATLKTRAGLDWTAKFKEIA
ADAKPLPDGLYDGEACALDHNGSPDFPALQAALSEDRTADLVFFVFDALFLDGEDLRALP
LTERKSRLEAAVAAAGKRLERRIRYVAHFETAGDAVLKSACRMSLEGIVSKRLDAPYRSG
RSDTWQKSKCRAGHEVVIGGWTGERGQLRSLLVGVNRDGKLVYVGRVGTGFGRETVGRVL
PRLEKVASDKSPFTGPNAPRKSGDINWARPELVAEIEFAGFTGDGNVRQASFKGLREDKP
AAEVEAETPAKTQLAEPAPAGKAKAGPRTAPAKPATKPRAKPRAKPRAGDNVVMGVVLSN
PDKALWPDDGKGGVVTKLDLARYLETVGPWMMEHIKGRPCSIIRMPDGIEGQQRFFQRHA
GKGSSALISEVQVFGDHKPYIQIDRIEALAALAQIGAVEYHPWNCQPGQPEVPGRLVFDL
DPDEAIPFQRVIDAAWEVKERLESLGLAAFCKTTGGKGLHVVTPLKAGKGEMDWPTAKAF
ARDVCLAIAADAPDRYVVNMAKAKRKGRIFLDYLRNDRMSTAVAPLSPRGRPLAPVSFPL
TWDQVKTGLEPKRWTIRTAPALLKKTKAWADYCDAERPLKDAIRKLK
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
ttggccgacaagctcgcccgctaccgggccatgcgcgacttctccaagacggccgagccg
gccggggccgagaagacgaaggcctcccggcgcctgcgcttcgtgatccagaagcacgcg
gccacccgcctgcactacgacttccggctcgagctggacggggtgttcctgtcgtgggcg
gtgaccaaagggccgtcgctgaaccccgccgaccgccggctggccgtgcagaccgaggac
caccccctcgactacggcgacttcgaaggcacgatccccaagggccagtacggcggcggc
acggtgatgctgtgggaccgcggctactgggagcccgagggcgacgccagggccatgctg
aagaagggcgacctgaagttcaccctggacggcgagcggctgaagggctcgtgggtgctg
gtccgcatgaagcgccgcgagcgcgagaagcgcgacaactggctgctgatcaagcaccac
gacggctggtcggtggaggaccacggcgagttcctcgtcgagggagagaccagctcggtc
gcctcgggccgcgccatggacgagatcgaggccggcaagggcaagggtccgacgaaattc
atgaccggcaagggccgcgcctcgggcaaggacgtctggcagtccaaccgcgccgacccg
aaggctccgccgcccgccgccgaaaaggccgcgccggcgccgaagctgaaggccgctgcc
ctgcccgggttcgtggccccccagctcgccaagtcggtggaccggccgccgcagggcgcc
ggctggggccacgagatcaagttcgacggctatcggctgcagctgcgcgtggagaacggc
aaggcgacgctgaagacccgcgcgggcctggactggacggccaagttcaaggagatcgcc
gccgacgcgaagcccctgcccgacggcctctacgacggcgaggcctgcgccctggaccac
aacggctcgcccgattttccggccctgcaggcggcgctgtccgaggacaggaccgcggac
ctggtgttcttcgtgttcgacgccctgttcctggacggcgaggacctgcgcgccctgccg
ctgaccgagcgcaagagccggctggaggcggccgtggcggcggccggcaagcgcctggag
cggcggatccgctacgtcgcccacttcgagacggccggcgacgcggtgctgaagtcggcc
tgccgcatgtcgctggagggcatcgtctccaagcgtctggacgcgccctaccgctcgggc
cgctccgatacctggcagaagtccaagtgccgcgccggccacgaggtggtgatcggcggc
tggaccggcgagcgcggccagctccgctcgctgctggtgggcgtgaaccgcgacggcaag
ctcgtctatgtcggccgggtaggcaccggcttcggccgcgagacggtgggccgcgtgctt
ccgcgcctggagaaggtcgcctcggacaagagccccttcacgggcccgaacgcccctcgc
aagagcggcgacatcaactgggcccggcccgaactggtcgccgagatcgagttcgccggc
ttcaccggcgacggcaacgtccgccaagcgtccttcaagggcctgcgcgaggacaagccc
gccgccgaggtggaggccgagacgcctgcgaagacgcagctcgccgagcccgcgccggcc
ggcaaggcgaaagccgggcccagaacggcgccggcgaaacccgcgaccaagcctagggcc
aagcccagggccaagcccagggcgggagacaacgtcgtcatgggcgtcgtcctgtccaat
ccggacaaggcgctctggcccgacgacggcaagggcggcgtggtcaccaagctggacctc
gcccgctacctggagacggtcggcccgtggatgatggagcacatcaagggccggccctgc
tcgatcatccgcatgccggacgggatcgagggccagcagcggttcttccagcgccacgcc
ggcaagggatcgtccgcgctgatctccgaggtgcaggtcttcggcgaccataagccgtac
atccagatcgaccggatcgaggccctggccgccctcgcccagatcggggccgtggaatac
cacccgtggaattgccagcccggccagcccgaggtcccggggcggctcgtcttcgacctt
gatcccgacgaggccatcccgtttcagcgggtgatcgacgcggcctgggaggtgaaggag
cggctggagagcctgggcctggccgccttctgcaagaccaccggcggcaagggcctgcac
gtggtcacgcccctcaaagccggcaaaggcgagatggactggccgacggccaaggcgttc
gcccgcgacgtctgcctggcgatcgccgccgacgcccccgaccgctacgtggtcaacatg
gccaaggccaagcgcaagggacggatcttcctcgactatctgcgcaacgaccggatgtcg
acggcggtggccccgctctcgccgcgcggacgtcccctggcgccggtgtccttcccgctg
acctgggaccaggtgaagacgggcctcgagccgaagcggtggacgatccgcaccgcgccc
gccctgctgaagaagaccaaggcctgggccgactactgcgacgccgagcgcccgctgaag
gacgccatccggaagctgaagtga

DBGET integrated database retrieval system