KEGG   Phenylobacterium zucineum: PHZ_c3271Help
Entry
PHZ_c3271         CDS       T00750                                 

Definition
(GenBank) glutathione S-transferase
Organism
pzu  Phenylobacterium zucineum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_N_4
Motif
Other DBs
NCBI-ProteinID: ACG79680
UniProt: B4RAT2
LinkDB All DBs
Position
complement(3713669..3714406)
Genome map
AA seq 245 aa AA seqDB search
MKIIGSYVSPYVRKVLACMALKGLAYEIDPITPFFGGEAFERISPLRRIPVLVDGDLTLC
DSSVICAYLDEAYPGHALLPAAPAARARARWLEEFADTRLGDVFIWGLFYQRNVKPIVWG
EPADEARVGKSLSTDIPAALDYLEGQLPADGFLFGEIGLADIALASFFRNAAYAGFEPDP
ARWPRTAAFVARTLAHPCLDSLLRYEDIQRSVTPAGRRAALLEAGAPLTAQTVGTRTPKR
GVMAL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcatcggcagctacgtcagcccctatgtccgcaaggtcctggcctgcatggcc
ctgaaggggctggcctacgagatcgacccgatcacgcccttcttcggcggcgaggcgttc
gagcggatcagtccgctgcggcgcatcccggtgctggtcgacggcgacctgacgctctgc
gattcctcggtcatctgcgcctacctggacgaggcctatccgggccacgccctgctgccg
gcggcccccgcggcccgggcccgcgcccgctggctggaggaattcgccgacacccggctg
ggcgacgtgttcatctggggcctgttctaccagcgcaacgtgaagccgatcgtctggggc
gagcccgccgacgaggcccgggtggggaagagcctttccaccgacatcccggcggcgctg
gactacctcgagggccagcttcccgcggacggcttcctgttcggcgagatcggcctcgcc
gacatcgccctggccagcttcttccgcaacgccgcctacgccggcttcgagcccgatccc
gcccgctggccgcggacagcggccttcgtggcgcgcaccctggcccacccgtgcctcgac
agcctcctgcgctacgaggacatccagcgcagcgtcaccccggccggacgccgcgcggcg
ctgctggaggccggcgcgccgctcaccgcccagacggtcggcacgcgcacgccgaagcgc
ggcgtgatggcgctctag

DBGET integrated database retrieval system