KEGG   Riemerella anatipestifer RA-CH-2: G148_1208Help
Entry
G148_1208         CDS       T02438                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component-related enzyme
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rae00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G148_1208
  Amino acid metabolism
   00310 Lysine degradation
    G148_1208
   00380 Tryptophan metabolism
    G148_1208
Enzymes [BR:rae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     G148_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1279887..1282595
Genome map
AA seq 902 aa AA seqDB search
MYQQYLKYPDSLEPSWKAFFQGFDFALENFGEDDSFTEKVGASSLSQQVGVPDDIIKEFK
VLNLIEAYRTRGHLFTRTNPVRERRTYLPDLSIENFGLSKSDLDTKFNSATETGMLGAAT
LADIIRHLDQIYCDSIGIEYMHIREVEEKEFIRQWISKNENHPELSADEKIQILSKLNQA
VAFENYLHTKFVGQKRFSLEGGESLIPALDQLISRSSKHGVDEVVLGMAHRGRLNVLTNI
FGKSYKQIFSEFEGKEFEEDVFSGDVKYHLGSTTKIKTAAGEEVIINLTPNPSHLETVAS
LVQGISRAKIDHTYGNNFKKVLPIVIHGDAAIAGQGIVYEIAQMMTLDGYKTGGTVHIVV
NNQVGFTTNYLDARSSTYCTDIAKVTDSPVMHVNADDVEAVVHAIRFAADYRAAFGKDVY
IDLLGYRKYGHNEGDEPRFTQPKLYNTIAKHPNPREIYKVKLEKEGVLSEGVLKKMEEEF
KTLLDKDFDASKEIQKNTLDVFMEQVWIKYLDPANKQKVLKAVETQYNAEQLKELAVKMS
SLPKDKAFIRKITRLFEQRLKMIEEDKLDWAMAELLAYATLLAEGYNVRISGEDVERGTF
SHRHAVVKTEDAEEEYVPLQHINESQQFHIYNSLLSEYAVLGFDYGYAMASPDTLTIWEA
QFGDFVNGAQIIVDQYLVAAEEKWKLQNGLVMLLPHGSEGQGAEHSSARLERFLTLCANN
NIFVANCTVPANYFHLLRRQMKFPFRKPLVVMTPKSLLRHPKVISSMEELANGSFQPVID
DATADASKVERLVMCSGKVYYDLLAKKEELGDEKVALVRLEQLYPLDSEKIETVLSKYSN
RKDFVWVQEEPENMGAWSYILRNFRKYDVQVIAPVPSGTPAPGSHKKYEINQTNVINQTF
GI
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagcagtacttaaaatacccagatagtttagagccatcttggaaagcttttttt
caagggtttgattttgctctagaaaattttggtgaagacgattcttttacagaaaaagta
ggtgcgtcttctttatctcagcaagtaggtgtcccagatgatattataaaggagtttaaa
gttcttaacttaatagaggcttatagaactagaggtcatttgtttactagaactaaccct
gttagagagagaagaacttatctccctgatttatctatagagaattttggattatcaaag
tcagatttagatactaaatttaactctgctacagaaacaggaatgctgggagctgctact
ttggcagacattattcgtcatttagaccaaatttattgcgactctatcggtatagaatat
atgcatattcgtgaggtggaggagaaggaatttattcgccagtggatttctaagaatgaa
aatcacccagaactttcggcagacgaaaaaatacagattttatctaagctcaatcaagcg
gtagcatttgaaaactatcttcatactaaattcgtaggacaaaagagattttcactggaa
ggaggagagtctttaatccctgctttagaccagcttattagtcgttcttcaaaacatggt
gtagatgaagtggttttgggtatggcacacagagggaggcttaatgtattaactaatatc
tttgggaaatcatacaagcaaatcttctctgaatttgaaggtaaagaatttgaggaagat
gtattttctggagatgttaagtatcacttaggttctactacgaaaataaaaacggctgca
ggagaagaggtaattatcaatttaacgcctaacccgtctcacttagaaactgtagcttct
ttagtacaaggtatttctagagctaaaatagaccatacttacggtaataattttaaaaaa
gtattaccgattgttatccatggagatgcagctattgcaggacaaggaattgtctacgag
attgcacaaatgatgactttagacggctacaagacaggaggaacggttcatattgtagtt
aataatcaggtaggatttacaaccaactatctagatgcgaggtcttctacttattgtacg
gatattgctaaggtaacagactcgcctgtgatgcatgtaaatgcagatgatgtagaggct
gtggtacatgcaattagatttgcggcagattatagagcagcgtttggcaaagatgtttat
atagatttgttaggatacagaaagtacggacataacgaaggtgatgagcctcgttttacg
cagcctaaactttataataccattgcgaaacaccctaatcctagagaaatatataaagta
aaactagagaaagaaggagtgctttctgaaggagtgttgaagaagatggaggaagaattt
aaaacccttcttgataaagattttgatgcatctaaagaaattcaaaaaaatactttagat
gtatttatggaacaggtttggattaagtatctagaccctgcaaataaacaaaaagttcta
aaggctgtagaaactcaatacaatgctgaacagttaaaagagttggcagttaagatgtct
tctttacctaaagacaaggcgttcataagaaaaatcactagactttttgaacaaaggcta
aaaatgatagaagaggataagttagattgggcaatggcagaacttttagcttatgctacg
cttcttgcagaagggtacaatgtgagaatttctggggaagatgtggagagaggtactttc
tctcaccgtcatgcagtggtaaaaacagaagatgcagaggaggaatatgtaccattacaa
catatcaacgaaagtcagcagtttcatatttataactcattactatcagagtacgctgtt
ttagggtttgattatggttatgctatggcatcgcctgatactttaaccatttgggaagca
cagtttggagatttcgtgaatggcgctcaaattattgtggaccaatatttggtagctgca
gaagaaaaatggaagctgcaaaatggtttggtaatgttgttacctcacggctctgaaggg
caaggtgcagaacactcttcggctaggttagagagatttttaacgctttgtgctaataat
aatattttcgtagctaactgtacagttccagccaattatttccatttattgagaaggcaa
atgaagtttccgtttagaaaaccgttagtggtaatgacacctaagtcgttactaagacac
cctaaggttatttcttctatggaagagttagcaaacggaagtttccaaccagtgattgat
gatgctacggctgatgcttctaaggtggagagattagtgatgtgttctggtaaggtttac
tacgatttattggctaaaaaagaggaattgggagatgagaaagtagctttagtaaggctg
gagcagttatatcctttggattcagagaaaatagagactgtgttgtctaaatattctaac
agaaaagattttgtatgggttcaagaagagccagagaatatgggagcttggtcttatatt
ttgagaaatttccgcaagtatgatgtacaagtaattgcaccagttcctagtggaacgcca
gcaccaggtagccataagaagtatgagattaaccaaactaatgtaattaaccaaacattt
ggtatctag

DBGET integrated database retrieval system