KEGG   Rahnella sp. Y9602: Rahaq_4736Help
Entry
Rahaq_4736        CDS       T01422                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00250  Alanine, aspartate and glutamate metabolism
rah00410  beta-Alanine metabolism
rah00640  Propanoate metabolism
rah00650  Butanoate metabolism
rah01100  Metabolic pathways
rah01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rahaq_4736
   00650 Butanoate metabolism
    Rahaq_4736
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rahaq_4736
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rahaq_4736
Enzymes [BR:rah01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Rahaq_4736
Amino acid related enzymes [BR:rah01007]
 Aminotransferase (transaminase)
  Class III
   Rahaq_4736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADW76316
JGI: Rahaq_4736
UniProt: A0A0H3FJ29
LinkDB All DBs
Position
pRAHAQ01:303585..304853
Genome map
AA seq 422 aa AA seqDB search
MSHSELEKRRKEATPRGVGVMCDFYAAKAENATLWDEHGREYIDFTAGIAVLNTGHRHPK
IVEAIRNQLDLFTHTSYQIVPYASFVNLAERINAISPVSGKAKTTFFSTGAEAVENAVKI
ARSATGRPGIITFSGAFHGRTLLTMALTGKVVPYKVGFGPFPASVFHAQYPNAVHGVTTE
MALDSIERIFRSDIAPQQIAAILYEPVQGEGGFNIAPEDFVKGLREICDRHGIVMIADEV
QSGFARTGKMFASEYYPDAKPDIVTMAKSLGGGLPISGVTGRAGLMDAPEPGGLGGTYAG
NPLAVASALAVLDIIEEEKLCERANRLGAELTEVLGKAKANCAALVDVRARGSMVAAEFN
DPVTGKPSSELTKQYLRKALDAGLLMLSCGVHGNVIRFLYPLTIPDVQFKEALAILSRVL
AD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacagtgaactggaaaaacgccgtaaagaagcgacgccgcgtggtgtaggtgtc
atgtgtgatttctatgcggcaaaagcagaaaatgccacgctgtgggatgaacacgggcgg
gaatacatcgatttcactgccgggattgcggttctgaacaccggacatcgtcacccgaaa
atcgttgaagccatccgcaaccagctcgacctgttcacacacacttcctaccagattgtg
ccttatgccagctttgtgaatctggctgaacgcatcaacgcgatttctccggtgagcggc
aaagcgaaaaccactttcttcagtaccggcgcggaagctgtcgaaaacgcggtgaaaatt
gcccgctccgccaccggtcgcccgggcatcatcactttctccggtgcatttcatggccgc
acgctgctgaccatggcgttgaccggcaaagtagtgccttacaaagtgggcttcgggccg
ttcccggcctcggtcttccacgcccaatatcccaacgccgttcacggtgtcaccactgaa
atggcactcgacagtattgaacgtatttttcgcagcgatatcgcgccgcagcaaattgct
gcgatcctgtatgagccggtacaaggcgagggcggtttcaatatcgcgccggaagatttc
gtgaaagggctgcgcgaaatctgtgaccgtcacggcatcgtgatgattgccgacgaagta
cagagcggctttgcgcgtaccggtaaaatgttcgcgtcagaatactatcccgatgccaaa
ccggacatcgtcacgatggcgaaaagcctcggcggcggtttgccgatctcgggcgtaacc
gggcgcgccgggctgatggacgcaccggagccgggcggccttggcggtacttacgcgggt
aatccgctggccgtggcctctgcgctggcagtgctggatatcatcgaagaagaaaaattg
tgcgagcgcgcaaatcgtctcggtgcagagctgactgaagtactcgggaaagccaaagcg
aattgtgcggcactggtggatgtccgtgcgcgtggttcaatggtggcggccgaatttaac
gatcccgtgaccggaaaaccttcttctgaactgaccaaacagtatctgcgcaaagcgctg
gacgccggattgctgatgctcagttgcggtgtgcatggcaacgtgatccgtttcctttat
ccgctgaccattcctgatgtgcagtttaaagaagccctggcaattttgtcccgtgtgctg
gctgactga

DBGET integrated database retrieval system