KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0231Help
Entry
Rahaq2_0231       CDS       T01770                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rahaq2_0231
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Rahaq2_0231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(247263..248774)
Genome map
AA seq 503 aa AA seqDB search
METKDLIVIGGGINGTGIAVDAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHQPHLRPAWMIRAGLFLYDHLGKRTSLPAS
KGLKFGSESVLKPELTKGFEYSDCWVDDARLVVVNAQEVEERGGEVRTRTRVTRAWREDG
LWMVEAEDIDTGKTFTWRAKGLVNATGPWVKHFFDDGLKLKSPYGIRLIKGSHIVVPRAH
NQPQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYHGDPKDVKIDDKEVGYLLKVYNDHF
KKQLTTEDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHDQDGKAPLLSVFGGKLTTYRK
LAEHALEKLVKYYPKAGPAWTKTAVLPGGKLNGDRDTYSASLRTRFKWLPESLARRYART
YGSQTELFLNEATSLESLGEDFGHGFYEAELRYLVEKEWVSQLDDAIWRRTKLGMWLDKA
QQQRIAEWLETHKQQKKHLSLAS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgtaattggtggcggtattaatggtaccggcatcgcagtc
gatgcagctggccgcgggctgtctgttctgctgcttgaagcgcaagacttggcctgcgcg
acctcttcggccagttctaaactgatccacggtggcctgcgctatctggaacattacgaa
ttccgtctggtcagcgaagcgctggctgaacgtgaagtgctgttgaaaatggcaccgcat
attgccttcccgatgcgtttccgtttaccgcatcagccgcatctgcgcccggcctggatg
atccgcgccggtttgttcctgtacgaccatctgggtaaacgcaccagcctgccggccagt
aaaggcctgaaattcggcagtgaatccgtgctgaagccagaactgaccaaaggttttgaa
tactcagactgctgggttgacgatgcgcgtttagtggtggtcaatgcacaggaagtggaa
gagcgtggcggcgaagtccgcacccgcacccgcgtgacccgtgcatggcgtgaagacggc
ctgtggatggtggaagctgaagacatcgataccggcaaaacctttacctggcgcgccaaa
ggtctggtgaacgccaccggcccgtgggtaaaacatttcttcgacgacggcctgaagctg
aaatcgccatacggcattcgtctgatcaaaggcagccatattgtggtgccgcgcgcgcac
aatcagccgcaggcctacattctgcaaaacgaagatcaccgcattgtgtttgtgatcccg
tggatggatgaattttctatcatcggcaccaccgacgtggaatatcacggcgatccgaaa
gatgtgaaaatcgatgataaagaagtcggttatctgctgaaagtctataacgatcacttt
aagaaacagctgaccaccgaagacatcgtctggacctattccggtgtgcgtccgttgtgc
gatgatgaatcagattcaccgcaggccgtgacccgcgattacacgctcgacgttcatgat
caggacggcaaagcgccgctgctttctgtcttcggcggcaaactgaccacttaccgtaaa
ctggccgaacacgcgctggaaaaactggtgaagtactatccgaaagctggcccggcgtgg
accaaaacggccgtgctgccgggtgggaaactgaacggcgaccgcgatacttacagcgcc
agtctgcgtacccgcttcaaatggttacctgaatcgctggcccgtcgttatgcacggact
tatggcagccagacagagttgttcctcaatgaggcaaccagtctggaatcgctgggcgaa
gatttcggtcacggattctatgaagcggaactgcgctatctggtggaaaaagagtgggtt
tcacagcttgatgatgccatctggcgtcgtaccaaactcggtatgtggctggacaaagcc
cagcaacaacgtatcgccgaatggctggaaacacacaaacagcagaagaaacacttgtcg
ctggcgtcgtga

DBGET integrated database retrieval system