KEGG   Rhodococcus aetherivorans: AAT18_12200Help
Entry
AAT18_12200       CDS       T03876                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
rav  Rhodococcus aetherivorans
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAT18_12200
   00520 Amino sugar and nucleotide sugar metabolism
    AAT18_12200
Enzymes [BR:rav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AAT18_12200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2644931..2645716)
Genome map
AA seq 261 aa AA seqDB search
MTQTMHPATPDPDLLGFGVDVGGSGIKGGVVDLSTGRLVGERIKILTPQPSTPQAVADTV
ARIVDEAQWTGPVGVTLPSVVTGGVARTAANIDPAWIGTDARTLFSSVLGDRPVSVLNDA
DAAGLAEDRFGAAKDASGVVILLTFGTGIGSAVLHNGDLLPNTEFGHMEIDGMEAEHRAA
SSVKENNEWTYKRWAKEVSLVLSRFEALLWPDLFIAGGGISRKHEKWIPLLTNRTPVVPA
ALRNAAGIIGAAYAAKTGVLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagacgatgcacccggccacgccggacccggaccttctcggattcggtgtcgac
gtcggcggcagcggcatcaagggcggcgtcgtcgatctgtccacaggccggttggtgggc
gagcgcatcaagatcctgaccccgcagccgtccaccccgcaggccgtcgccgacacggtc
gcccggatcgtggacgaggcgcagtggacgggaccggtgggggtcaccctgccgagcgtg
gtgacgggcggcgtggcgcgcacggccgcgaacatcgatccggcgtggatcggcaccgac
gcccggacgttgttctcgtcggttctgggcgaccgcccggtgagtgtcctgaacgacgcg
gacgccgccggcctcgccgaggaccgcttcggcgcggccaaggacgcgtccggggtggtc
atcctgctcacgttcgggaccgggatcggctcggcggttttgcacaatggcgatctgctg
ccgaacaccgagttcgggcacatggagatcgacgggatggaggccgagcaccgcgcggcg
tcgtcggtcaaggagaacaacgagtggacgtacaagcggtgggcgaaggaggtctcgctg
gtgctgtcgcggttcgaggccctgttgtggcccgacctgttcatcgccggtggcgggatc
agccgcaagcacgagaagtggatcccgttgctgaccaaccgcacacccgtcgttccggcc
gcattgcgcaacgcggccggcatcatcggggccgcctacgctgcgaaaacaggtgtactc
ccctga

DBGET integrated database retrieval system