KEGG   Rhodococcus aetherivorans: AAT18_14660Help
Entry
AAT18_14660       CDS       T03876                                 

Definition
(GenBank) acyl-phosphate glycerol 3-phosphate acyltransferase
Organism
rav  Rhodococcus aetherivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3246519..3249314
Genome map
AA seq 931 aa AA seqDB search
MSEPATPGQDDALLLSVVRDLVAERYTVDRAAGTRLDSVFDRDLGLDSLAVTELISRVED
AFGVSLERGVLGTVTTPRQLLTAVHHAPARERRRPVPARRAAPPCTDRTPDATATLTEAL
SWHARTHPDRVHLRILTEGHQSEISYGELHSAAATVSAALLAHDLRPGDAVGLMLPTSRD
YFTTFTGVLLAGGVPVPVYPPARPSQLAEHLRRQVHILDNARTRVLVTDPEAARLARLTR
GQVETVRHVLTPGDLAGCGEATGGPRGAGDIALLQYTSGSTGDPKGVTLTHANLLANIRA
MGKAAEVSTSDVFVSWLPLYHDMGLIGAWLSGLYFGVPLAVMSPLEFLARPAQWLWAIHT
HRGTLSAAPNFAYELCLRRIADADVEGLDLGSLRMLFNGAEAVNADTVIRFGERFAAYGL
RRESLAPVYGLAEACVGLTFPPVGRGPVIDSVARERFLRTGRAAPATDEDPNPLRFVACG
RPIPDHRIRVVDSAANVLGDRREGRIEFRGPSATAGYFRNPQATKALSRHGWLDTGDLGY
LDDGELYVTGRIKDLVIRAGRNLHPEELERAVGEIPGLRKGCVAVFATSAQTAGTERLVV
LAETRETETATLDRLRERIVGVSVDLLGTPPDDIVLAPPGTVRKTSSGKIRRSATRQRYE
QGDVRARPRPVWWQLTRFAVRGAIPSLRRAAQLVRTGAFALWCWSMVLAVGLPTLIAMAV
LPRLPARRAAARRAARGLARLTRTPVTAQGAEHLVRLPNCVVVANHASFLDGIALSTILP
GRYTFVAGEVFERKPFIGFLLRRIGTRFVERTEREQSVADADRLVEEARAGGRLVVFPEG
ALSPVPGLRSFHLGAFVIAARAGLPVVPVAITGTRAMMWPDHGRIIHRGAIHLVVGEPIL
PSGDGWDAAVALERAARAVIAEHCGEPDSGR
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcctgcgaccccggggcaggacgatgccctgctgctctcggtggtccgggat
ctggtggccgagaggtacacggtcgatcgcgcggccggcacacggctcgacagcgtcttc
gatcgtgatctcgggctcgacagtctcgcggtcaccgagctgatctcccgcgtcgaggat
gcgttcggggtgagcctggagcgtggggtgctcggcaccgtgaccaccccgcgtcagctg
ctgacggcggtgcaccacgcacccgcgcgggagcgccgccggccggtgcccgcgcgacgg
gcggcgcccccatgcaccgaccggacgccggacgcgaccgcgaccctgaccgaggcgctc
tcgtggcacgcccgcacccatccggatcgggtccacctgcgcattctcaccgagggacac
cagagcgagatcagctacggcgagctgcattccgcggctgccacggtgtccgccgcgctg
ctcgcccacgatctccggcccggtgacgcggtcggcctcatgctccccaccagccgggac
tacttcaccacgttcaccggcgtgctcctggccgggggcgtcccggtaccggtctatccg
ccggcgcgtccctcccagctcgccgagcacctccgtcggcaggtgcacattctcgacaac
gcacggacccgtgtgctggtcaccgacccggaggccgcccgcctggcccggttgacgcgc
ggccaggtggagacggtgcgccacgtcctgaccccgggcgacctggccggctgcggggag
gcgaccggcggaccgcgcggcgccggcgacatcgccctgttgcagtacacctccggcagc
accggcgaccccaagggcgtgaccctgacccacgcgaatctgctcgccaacatccgtgcg
atgggcaaggcagccgaggtctccacctccgacgtcttcgtcagctggctgccgctctac
cacgacatgggcctgatcggcgcctggttgtccggcctgtacttcggggtgccgctggcg
gtgatgtccccgctggagttcctcgcccgcccggcgcagtggctgtgggcgatccacacc
caccgcggcaccctgtcggcggctccgaacttcgcctacgagttgtgcctgcgccgaatc
gccgacgccgacgtcgaggggctcgacctcggctcgctgcgcatgctgttcaacggcgcc
gaggccgtgaacgcggacaccgtgatccggttcggcgagcggttcgccgcctacggactc
cgccgcgagtccctggccccggtctacgggctggccgaagcatgtgtcggcctcaccttc
ccgcccgtgggacggggaccggtgatcgattcggtcgcccgcgaacgtttcctgcgcacc
ggccgggcggcccccgccaccgacgaggacccgaacccgctgcgcttcgtcgcctgcggc
cggccgatcccggatcaccggatccgggtggtcgactcggctgcgaacgtgctcggcgac
cggcgcgagggccggatcgagttccgcggcccctcggccaccgcggggtacttccgcaac
ccgcaggcgaccaaggcgctgtcccggcacggctggctcgacaccggcgacctcggctat
ctcgacgacggcgaactctacgtcaccggccgcatcaaggacctcgtcatccgcgcgggc
cgcaacctgcacccggaggagctcgagcgggcggtgggcgagatcccgggactccggaag
ggctgcgtggcggtcttcgcgacctccgcgcagaccgccggcaccgaacgcctggtcgtg
ctggccgagacgcgcgagaccgagacagccaccctggaccggctccgggagcgcatcgtc
ggggtctccgtggatctgctcggaacaccgccggacgacatcgtgctcgccccacccgga
acggtgcgcaagacctcgagcggcaagatccggcgttccgccacccggcaacgctacgag
cagggcgacgtgcgggcccgtccccggccggtgtggtggcagctgacccgcttcgcggtc
cgcggcgcgatcccgagcctgcggcgggcggcgcagctcgtccggaccggtgcgttcgcc
ctgtggtgctggtcgatggtcctcgcggtcggcctgccgaccctgatcgccatggcggtg
ctgccccgcctcccggcgcgccgcgcggccgcgcgcagggccgcccgcggtctcgcccgc
ctgacccgcaccccggtgaccgcgcaaggggccgagcatctcgtgcggctgccgaactgc
gtagtggtcgccaaccacgccagcttcctcgacggcatcgcgttgtcgacgatcctgccg
ggccgctacacgttcgtggccggggaggtcttcgagcgcaagccgttcatcggtttcctc
ctgcggcggatcggtacgcggttcgtcgaacggaccgaacgtgagcagagcgtggccgac
gccgatcggctggtcgaggaggcacgcgccgggggccgcctggtggtgttccccgaaggc
gcgctgtcgccggtgcccgggctccggtccttccacctgggtgcgttcgtgatcgccgca
cgggcgggtcttccggtggtccccgtcgcgatcaccggcacccgcgcgatgatgtggccc
gatcacggcaggatcatccaccgcggagcgatccacctcgtcgtcggcgagccgatcctc
ccgtccggagacggctgggacgcggccgtcgcgctggagcgcgcagcgcgggccgtgatc
gccgaacactgcggagagcccgacagcggccgctga

DBGET integrated database retrieval system