KEGG   Rhodococcus aetherivorans: AAT18_21805Help
Entry
AAT18_21805       CDS       T03876                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
rav  Rhodococcus aetherivorans
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rav00001]
   00640 Propanoate metabolism
    AAT18_21805
   00650 Butanoate metabolism
    AAT18_21805
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AAT18_21805
   00280 Valine, leucine and isoleucine degradation
    AAT18_21805
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AAT18_21805
Enzymes [BR:rav01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AAT18_21805
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AAT18_21805
Amino acid related enzymes [BR:rav01007]
 Aminotransferase (transaminase)
  Class III
   AAT18_21805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4875259..4876647
Genome map
AA seq 462 aa AA seqDB search
MTSIEYRLPQQRRLVTALPGPRSAALTERRRTAVGAGVASSVPVYAADVDGGIVVDVDGN
ALIDLGSGIAVTSVGASDPAVVAAVQEQVAHFTHTCFMVTPYEGYIAVAEKLAALTPGDH
AKRTVLFNSGAEAVENAVKIARVATGRSAVVVFDHAYHGRTNLTMALTAKNQPYKEGFGP
FAPDIHRVPASYPFREGRNYDGTEVTGEQAAHRAIAQIDKQIGAHNVAAIVLEPIQGEGG
FIVPAKGFLPTLVDWAKANGIVFVADEVQTGFARTGDWFASNDENVVPDLMTLAKGIAGG
MPLAAVTGRAELIDAVHGGGLGGTYGGNPVACAAALATLDRIEQLDLCGRARRIEQIATE
RLRALAADVDIVGEVRGRGAMLAVEFVQPGTREPNPEATKAIAAKALEQGVIVLTCGTYG
NVVRLLPPLVISDELLTDGLDVLAAAVRDVAGVRPTLAGATR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcatcgaataccgccttccgcagcagcgtcgcctggtcaccgcgctgcccggc
ccgcgctcggcggcactgaccgagcgtcgccgcacggccgtcggggcgggtgtggcctcc
tccgtgccggtctacgccgccgacgtcgacggcggcatcgtcgtcgacgtcgacggcaac
gccctgatcgacctcggttccggcatcgcggtcaccagtgtcggcgcctcggacccggcg
gtcgtggcggcggtgcaggagcaggtcgcgcacttcacgcacacctgcttcatggtcact
ccctacgagggctacatcgccgtcgccgagaagctcgcggccctgacccccggcgaccac
gccaagcgcacggtgctgttcaacagcggcgcggaggcggtggagaacgcggtcaagatc
gcccgggtcgcgaccggtcgcagcgccgtggtggtcttcgaccacgcctaccacggccgc
accaacctgacgatggcgctgaccgcgaagaaccagccctacaaggagggcttcggcccg
ttcgccccggacatccaccgcgtgccggcgtcgtacccgttccgcgagggccgcaactac
gacggcaccgaggtcaccggtgagcaggccgcccatcgcgcgatcgcgcagatcgacaag
cagatcggtgcgcacaacgtcgccgcgatcgtgctcgagcccatccagggcgagggcgga
ttcatcgtgccggccaagggtttcctgccgaccctcgtcgactgggcgaaggccaacggc
atcgtcttcgtcgccgacgaggtgcagaccggcttcgcgcgcacgggcgactggttcgcc
agcaacgacgagaacgtcgtgccggacctgatgaccctcgccaagggcatcgccggcggc
atgccgctcgccgcggtgaccggccgcgccgagctgatcgacgccgtccacggcggcggc
ctcggcggcacctacggcggcaaccccgtcgcgtgcgccgcggcgctggccacgctggac
cggatcgagcagctggacctgtgcggccgcgcccggcgcatcgagcagatcgccaccgag
cggctgcgggcgctcgccgcggacgtcgacatcgtcggcgaggtccgcggccgcggcgcg
atgctcgccgtcgagttcgtgcagcccggcacgcgcgagccgaatccggaggccaccaag
gcgatcgccgcgaaggcgctcgagcagggtgtcatcgtgctcacctgcggcacctacggc
aacgtcgtccgcctgctgccgccgctggtgatctccgacgagctgctcaccgacggcctc
gacgtcctcgctgccgccgtccgcgatgtcgcgggcgtgcgcccgaccctggcaggagcc
acccgatga

DBGET integrated database retrieval system