KEGG   Rhodothermaceae bacterium RA: AWN76_001565Help
Entry
AWN76_001565      CDS       T04780                                 

Definition
(GenBank) DNA ligase
Organism
rbar  Rhodothermaceae bacterium RA
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(365778..366368)
Genome map
AA seq 196 aa AA seqDB search
MTDDLAAYRHRRDLAASGEPEGSASSSSGEHPIFVIQKHDARTLHYDVRLEVDGVLKSWA
VPKGPSTDPSVRRLAQPTEDHPLDYARFEGVIPEGHYGAGTVLVWDTGTYRNLRAEKPDD
GASMQQSLEEGKVEVWLDGRKLRGGYALIRMKDRDGWLLIKMNDDEADARRNPVRTEPDS
VLTGRSLDEIRAQEGD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacctcgcagcctaccgccacaggcgcgacctcgccgcctcgggagaaccc
gagggctccgcctcctcctcgtccggcgagcaccccatcttcgtgatccagaaacacgat
gcccgtacgctgcactacgacgttcggctggaggtggacggcgtgctgaaatcgtgggcc
gtgccgaaagggccgtcgaccgatccgagcgtccggcggctcgcccagccgacggaggat
cacccgctcgactatgcccgcttcgagggcgtcatccccgaggggcactacggtgccggg
accgtcctcgtctgggataccggcacgtaccgcaacctccgcgcggagaagccggacgac
ggggcttcgatgcagcaatcgctggaggaaggcaaggtggaagtgtggctggatggccgg
aaactgcggggcggctacgccctcatccgcatgaaggaccgcgacggctggctgctcatc
aagatgaacgacgacgaggcggacgcccgccgcaaccccgttcgcaccgaacccgattcc
gtcctgaccggccgcagcctcgacgagatccgcgcgcaggaaggcgactga

DBGET integrated database retrieval system