KEGG   Rhodothermaceae bacterium RA: AWN76_009625Help
Entry
AWN76_009625      CDS       T04780                                 

Definition
(GenBank) hypothetical protein
Organism
rbar  Rhodothermaceae bacterium RA
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2358739..2362119
Genome map
AA seq 1126 aa AA seqDB search
MSPSPTAPSPRFSTLIDLLRHRAHHEPDRLAYTFLPDGEVGAGDTAVSLTYGELDRQARA
IAARLQAVEAAGERALLLYPSGLEYIAAFFGCLYAGVTAVPAYPPRKNRSLDRIDGIVSD
ARASLVLTTTPILSMIERHLAEHPDLGVAHEIPTDTLPLDHADDWVPPAVDADTLAFLQY
TSGSTGSPKGVMVSHGNLLHNEAVMQRAFQTHAGSRVASWLPLYHDMGLIGMMLQPLYAG
FPCVFTAPVAFLQKPIRWLRMIAEYRATISGGPDFAYDLCARKITPDQCEGLDLSSWEVA
FNGSEPVRAETIERFTEAFAPYGFRREAFVPCYGLAEATLFVTGIPKDEPPRIEQVDADA
LARHEVVYGAAPAMRSLVSSGRLWDGVEVRIVNPDTRTLCAPGEVGEIWVSGGSVTRGYW
QRPDETAETFEATLSGANGSPALRTGDLGFIQDGNLFVTGRLKDLIIIRGRNHYPQDIEA
TVARAHPALRPGAGAAFAITVDGEEHLAVVQEVRRSALRNLDVEAVIGAIRRAVSEEHEL
HAHTVVLLKTGSLPKTTSGKIQRRACHAALLAGTLHEVGRDAPAAEPADEPAPNGALDRT
TLRALPPDERRPLIAYRLQQLVARALKLPLARVDRQQPLGALGLDSLDVVELKLAIENDL
GVSLAVDEELNDLSIDRIARKLSAQFTPESTGNEPADEPPSGPVETDLFAKCDTDGGYFG
TYRLQKDTYFTQPVLEGPIGPHMRFQGREVITWSINNYLGIAQDPHVHERARRAIEEHGP
WSPMGSRLMTGNTERHMALERRLARYLRKEASIVWNYGYMGVMGTIASLVNGNDTVIIDS
LSHACIVDGAMVAAAGKPFRVFRHNDLDSLESQLRAAHEKRRGGILVVTEGVFGMTGDLA
PLPEICDLVERFGARLFVDDAHGFGIMGPTGAGTAEHLGVQDRLDLYFGTFAKSFAAIGG
VTAGDERVVDYIRYNARTNIFAKSLPMVYIEAVDAALDLIENGEDRRARVWHIARRLQTG
LAELGFDIGSTASPITPVYVPAGDEATTLRAIRMLRDELGIFASAVTYPVVPRGVMLFRL
TSTAAHTDEDVDRTLEAFRILRDRLNLRHVTGDGSVGSVNLTGRAS
NT seq 3381 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgtctcccaccgctccctccccccgcttctctaccctgatcgacctgctccgg
caccgtgcccaccacgaaccagatcgcctcgcctacacgttcctgcccgacggagaggtc
ggggctggagacaccgccgtctcgctgacctacggcgaactcgaccggcaggcccgggcc
atcgcggcgcggctgcaggcggtcgaggcagcgggcgaacgcgcgctgctgctctacccc
tccgggctggaatacatcgcggcgttcttcggctgcctctatgccggggtgacggcggtg
ccggcctacccgccccgaaaaaaccgctcgctcgaccgcatcgacggcatcgtctccgac
gccagagcgtcgctcgtgctgacgaccacgcccatcctgtcgatgatcgagcgccatctg
gccgagcaccccgacctgggcgtggcgcacgagatcccgaccgacacgctcccgctcgac
cacgccgacgactgggtgccgccggccgtcgatgccgatacgctggccttcctgcagtac
acctccggctcgacgggctcgcccaagggggtcatggtcagccacggcaatctgctgcac
aacgaggccgtgatgcagcgggcctttcagacgcacgcgggctcgcgggtggccagctgg
ctgccgctctaccacgacatggggctcatcggcatgatgttgcaaccgctctatgccggc
ttcccctgcgtctttaccgctccggttgccttcctccagaagccgatccgctggctgcgc
atgatcgccgagtaccgggccaccatcagcggcgggccggacttcgcctacgacctgtgt
gcccgcaagatcaccccggaccagtgtgaaggcctggacctgagttcctgggaagtggcc
ttcaacggctccgagcccgtgcgcgccgagaccatcgagcgcttcaccgaagccttcgcg
ccctatggcttccgccgcgaagccttcgtgccgtgctatggcctggccgaggccacgctg
ttcgtcaccggcatcccgaaagacgaaccgccccgcatcgaacaggtcgatgccgacgca
ctggcccgccacgaagtcgtctatggggcggctccggccatgcggtccctggtcagctcg
ggccgcctctgggacggcgtggaggtccgcatcgtcaaccccgacacgcggacgctgtgt
gcccccggcgaggtcggggagatctgggtctcgggcggcagcgtgacccgcggctactgg
cagcgaccggacgaaacggccgaaaccttcgaagccacgctgagcggggccaacggctcc
ccggccctgcgcacgggcgacctgggctttatccaggacggcaacctgttcgtcaccggc
cggctcaaggacctcatcatcatccgcggtcgcaaccactacccgcaggacatcgaggcc
acggtggcccgcgcccacccggcgctgcgccccggcgccggggccgccttcgccatcacc
gtcgacggcgaggaacacctggccgtggtgcaggaggtgcggcgcagcgccctgcgcaac
ctcgacgtggaggccgtcatcggcgccatccgccgggccgtctccgaggaacacgaactc
cacgcccacaccgtcgtgctcctcaaaaccggcagcctgcccaagacgaccagcggcaag
atccagcgcagagcctgccatgcagccctgctggccggcacgctgcacgaggtcgggcgc
gacgccccggccgccgaaccggccgacgaaccggcgccaaacggggcgctcgaccgcacc
acgctccgggcgctgccgcccgacgagcggcgcccgctcatcgcctatcgcctccagcaa
ctcgtcgcccgcgccctcaagctccccctcgcccgcgtcgaccggcaacagcccctgggc
gccctcggcctggactcgctggacgtcgttgaactcaaactcgccatcgaaaacgacctg
ggcgtgtcgctggccgtggacgaggaactgaacgacctcagcatcgaccggatcgcccgg
aagctctcggcccagttcaccccggagagcaccggcaacgaaccggccgacgaaccgccg
tccggccccgtcgagacggacctcttcgccaagtgcgacaccgacggcggctacttcggc
acgtaccggctgcagaaggacacgtacttcacgcagcccgtgctggagggacccatcggc
ccccacatgcgcttccaggggcgggaggtcatcacgtggtcgatcaacaactacctcggc
atcgcgcaggacccgcacgtgcacgagcgggcgcgccgcgccatcgaggagcacgggccc
tggtcccccatgggctcgcgcctgatgacgggcaataccgagcggcacatggctctggaa
cgccgcctggcccgctacctccggaaggaagcctccatcgtctggaactatggctacatg
ggggtgatgggcaccatcgcctcgctcgtcaacggcaacgacacggtcatcatcgacagc
ctctcgcacgcctgcatcgtcgacggggcgatggtggccgccgccggcaagccgttccgc
gtcttccgccacaacgacctcgacagcctggagagccagctccgcgccgcccacgagaaa
cgacgcggcggcatcctcgtcgtcaccgaaggcgtcttcggcatgaccggcgacctggcg
ccgctgcccgagatctgcgacctggtcgaacgcttcggcgcccgcctgttcgtcgacgac
gcccatggcttcggcatcatgggcccgacgggcgccggcaccgccgaacacctcggcgtg
caggaccgcctcgacctctacttcggcaccttcgccaagtcgttcgccgccatcggaggg
gtgacggccggggacgagcgcgtggtcgactatatccgctacaacgcccgcacgaacatt
ttcgccaagagcctgccgatggtctacatcgaggccgtcgatgcggcgctggacctgatc
gaaaacggcgaggaccggcgcgcccgggtctggcacatcgcccggcgcctgcaaaccggc
ctggccgaactgggcttcgacatcggcagcaccgcctcgccgatcacgcccgtctacgtc
ccggccggcgacgaagccaccacgctccgggccatccgtatgctgcgggacgaactcggc
atcttcgcctcggccgtcacctatcccgtcgtcccccggggcgtcatgctcttccgcctg
acctccaccgccgcacacacggacgaggacgtggaccgcaccctggaggccttccgcatc
ctccgcgaccggctgaacctgcgacacgtcaccggggacggcagcgtgggatcggtcaac
ctgaccggccgcgcttcctga

DBGET integrated database retrieval system