KEGG   Rhodothermaceae bacterium RA: AWN76_014560Help
Entry
AWN76_014560      CDS       T04780                                 

Definition
(GenBank) galactose-1-epimerase
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rbar  Rhodothermaceae bacterium RA
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rbar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWN76_014560
   00052 Galactose metabolism
    AWN76_014560
Enzymes [BR:rbar01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AWN76_014560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3604868..3606019
Genome map
AA seq 383 aa AA seqDB search
MHVRVHRILGTLLAGLFLNACSPSSQPPTTMLTQTPFGTTADGEAVTMYTLTRAGGMEVR
LLNYGGIITSLKVPDRNGRLEDVVLGFDTLAPYLERHPYFGAIIGRYGNRIAGGQFTLDG
TTYTLAQNDGPNHLHGGLRGFDRVVWQAEPFEEPGRVGVVLTYTSPDGEEGYPGTLQAKV
TYTLTDDDELIVDYEATTDKATPVNLTQHTYFNLAGHDSGDVLDHELTIHADHYLPVDST
LIPTGERRPVAGTPFDFRRPTPIGARIEADDPQLHWGPGGYDHTFVLNRTGDGLEPAARV
YEPTSGRVLEVRTTEPGVQFYSGNFLDGSLVGKGGAVYARHAGFCLETQHFPNSPNQPDF
PSTILRPGETYSSRTVFAFSVQD
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgcgggttcatcgcatcctcgggacgctgctggccgggctgtttctgaatgcc
tgctcgccgtcctcgcagccgcctaccaccatgctcacgcaaacgcctttcggcaccacg
gccgacggggaggccgtcacgatgtacacgctcactcgggccggcggcatggaggtccgc
ctcctgaactacggcgggatcatcacgtcgctgaaagtgccggaccgaaacggacggctg
gaggacgtcgtgctcggcttcgacacgctggcgccctacctggagcgccatccctacttc
ggcgccatcatcggccgctacggtaaccgcatcgccggggggcagttcacgctggacggt
acgacatacacgctggcccagaacgacggccccaaccacctccacggcggcctcaggggg
ttcgaccgggtggtctggcaggccgagccgttcgaggagccgggccgcgtcggggtggtc
ctgacctataccagcccggacggcgaggagggataccccggcacgctccaggcgaaggtc
acctacacgctgaccgacgacgacgaactgatcgtcgactacgaggcgacgacggacaag
gccacgccggtcaacctcacgcagcatacctacttcaacctggccggccacgatagcggc
gacgtcctggatcacgaactgacgatccacgccgatcactacctgccggtcgacagcacg
ctgatccccaccggcgagcggcgcccggtggcgggcacacccttcgacttccgccggccg
acgcccatcggcgcgcgcatcgaggcggacgatccgcagttgcactgggggccgggcggc
tatgaccacacgttcgtcctgaaccgcaccggggacggcctggagccagcggcccgcgtc
tacgagccgaccagcggacgcgtcctggaggttcgcaccaccgagccgggcgtgcagttc
tattccggcaatttcctcgacggctcgctggtcggcaagggcggggccgtctatgcccgg
catgccggcttctgcctcgaaacccagcacttcccgaactcccccaaccagcccgacttc
cccagcaccatcctgcgtcccggggagacctactcctcgcgtacggtcttcgccttttcc
gtacaggattga

DBGET integrated database retrieval system