KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515947Help
Entry
108515947         CDS       T04641                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb05034  Alcoholism
rbb05165  Human papillomavirus infection
rbb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    108515947 (HDAC7)
  Substance dependence
   05034 Alcoholism
    108515947 (HDAC7)
  Infectious diseases
   05165 Human papillomavirus infection
    108515947 (HDAC7)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108515947 (HDAC7)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108515947 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 108515947
NCBI-ProteinID: XP_017708615
LinkDB All DBs
Position
Un
AA seq 952 aa AA seqDB search
MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVG
PQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHSNSPGIPYRTLEPL
ETEGAARSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKE
SAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSL
APFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPXGPILGSPHTPLFLPHGLEPEAGG
TLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEP
LPPSATAPPPLGPMQPRMEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVV
DDGLEHRELSHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRP
LSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSR
HPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLD
NGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNG
FAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQ
DPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWTGGLDPPMGDPEYLAAFRT
VVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALE
GGHDLTAICDASEACVAALLGNKVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQR
LASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcgggtgggccagcggcccccagtggagcccccaccagagcccacattgctg
gccctgcagcgtccccagcgcctgcaccaccacctcttcctagcaggcctgcagcagcag
cgctcggtggagcccatgaggctctccatggacacaccgatgcccgagttgcaggtggga
ccgcaggaacaagagttgcggcagcttctccacaaggacaagagcaagcgaagtgctgta
gccagcagcgtggtcaagcagaagctggcggaggtgattctgaaaaaacagcaggcggcc
ctagagagaacagtccattccaacagccccggcattccctacagaaccctggagcccctg
gagacggaaggagccgcccgctccatgctcagcagctttttgcctcctgttcccagcctg
cccagtgaccccccagagcacttccctctgcgcaagacagtctctgagcccaacctgaag
ctgcgctataagcccaagaagtccctggagcggaggaagaatccactgctccgaaaggaa
agtgcgccccccagcctccggcggcggcctgcagagaccctcggagactcctccccaagt
agtagcagcacgcctgcgtcagggtgcagctcccccaatgacagcgagcacggccccaat
cccatcctgggctcggaggcgctcttgggccagcggctgcggctgcaggagacttctctg
gccccgttcgccttgccgacagtgtccttgctgcccgcaatcacgctggggctgcccgcc
cctgccagggctgacagtgaccgcaggacccatccgactctgggccctncggggccgatc
ctggggagcccccacactcccctcttcctgccccatggcctggagcccgaggctgggggc
actttgccctctcgcctgcagcccattctcctcctggacccctcaggctctcatgccccg
ctgctgactgtgcccgggcttgggcccttgcccttccactttgcccagtccttaatgacc
accgagcggctctccgggtcaggtctccactggccactgagccggactcgctcagagccc
ctgccccccagtgccaccgctcccccaccgctgggccccatgcagccccgcatggagcag
ctcaaaactcacgtccaggtgatcaagaggtcagccaaaccgagtgagaagccccggctg
cggcagataccttcggctgaagacctggagacagatggtgggggaccgggccaggtggta
gacgatggcctggaacacagggagctgagccatgggcagcctgaggccagaggccctgct
cctctccagcagcacccccaggtgttgctctgggaacagcagcgactggctgggcggctc
ccccggggcagcaccggggacactgtgctgcttcctctggctcagggtgggcaccggcct
ctgtcccgggctcagtcttccccagccgcacctgcctcactgtcagccccggaacctgcc
agccaggcccgagtcctctccagctcagagacccctgccaggaccctgcccttcaccaca
gggctgatctatgactcggtcatgctgaagcaccagtgctcctgcggtgacaacagcagg
cacccggagcatgccggccgcatccagagcatctggtcccggctgcaggagcggggactc
cggagccagtgtgagtgtctccgaggccggaaggcctccctggaggagctgcagtcggtc
cactctgagcggcacgtgcttctctatggcaccaacccgctcagccgcctcaaactggac
aacgggaagctggcagggctcctggcacagcggatgtttgtgatgctgccctgtggtggg
gttggggtggacactgacaccatctggaatgagctgcattcctccaatgcagcccgctgg
gccgctggcagtgtcactgacctcgccttcaaagtggcttctcgtgagctgaagaatggt
ttcgctgtggtgcggcccccaggacaccatgcagatcattcaacagccatgggcttctgc
ttcttcaactcagtggccatcgcctgccggcagctgcaacagcagagcaaggctagcaag
atcctcattgtagactgggacgtgcaccatggcaacggcacccagcaaaccttctaccaa
gaccccagtgtgctctacatctccctgcatcgccatgacgatggcaacttcttcccgggg
agtggggctgtggatgaggtaggggctggcagcggtgagggcttcaatgtcaatgtggcc
tggactggaggtctggatccccccatgggggatcctgagtacctggctgctttcaggaca
gtcgtgatgcccattgcccgagagttctctccagacctagtcctggtgtctgctggattt
gatgctgctgagggtcacccagccccactgggtggctaccatgtttctgccaaatgtttt
gggtacatgacgcagcaactgatgaacctggcaggaggtgcagtggtgctggccttggag
ggtggccatgacctcacagccatctgtgacgcctctgaggcctgtgtggctgctcttctg
ggtaacaaggtggatcccctttcagaagaaggctggaaacagaaacccaacctcaatgcc
atccgctctctggaggccgtgatccgggtgcacagtaaatactggggctgcatgcagcgc
ctggcctcctgtccagactcctgggtgcctagagtgccaggggctgacaaagaagaagtg
gaggcagtgaccgcactggcatccctctctgtgggcatcctggctgaagacaggccctcg
gagcagctggtggaggaagaagaacctatgaatctctaa

DBGET integrated database retrieval system