KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108517467Help
Entry
108517467         CDS       T04641                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rbb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108517467 (SUV39H1)
Enzymes [BR:rbb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108517467 (SUV39H1)
Chromosome [BR:rbb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108517467 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108517467 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 414 aa AA seqDB search
MELGERGPGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQE
YYLVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYL
VQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVA
VGCECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQ
KGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYL
FDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAG
EELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggagctcggggagcgcgggcctggctgcagcgtatgttgcaagtcttcttggaatcag
ctgcaggacctgtgccgcctggccaagctctcctgccctgccctcggtatctctaagagg
aacctctatgactttgaagtcgagtacctgtgcgattacaagaagatccgcgaacaggaa
tattacctggtgaaatggcgcggatatccagactcagagagcacctgggagccacggcag
aatctcaagtgtgtgcgtatcctcaagcagttccacaaggacttagagagggagctgctc
cggcggcaccaccggtcaaagaccccccggcacctggacccaagcttggccaactacctg
gtgcagaaggccaagcagaggcgggcactccgtcgctgggagcaggagctcaatgccaag
cgcagccatctgggacgcatcactgtagagaatgaggtggacctggacggccccccgcgg
gccttcgtgtacatcaatgagtaccgtgttggtgagggcatcaccctcaaccaggtggct
gtaggctgcgagtgccaggactgtctgtgggcacccactggaggctgctgcccgggggcg
tcactgcacaagtttgcctacaatgaccagggccaggtgcggcttcgagccgggctgccc
atctacgagtgcaactcccgctgccgctgtggctatgactgcccgaatcgcgtggtacag
aaaggcatccgatatgacctctgcatcttccgcacagatgatgggcgtggctggggcgtc
cgcaccctggagaagattcgcaagaacagcttcgtcatggagtacgtgggagagatcatt
acctcagaggaggcggagcgacggggccagatctacgaccgccagggtgccacctacctc
tttgacctggactacgtggaggacgtgtacaccgtggatgccgcctactatggcaacatc
tcccactttgtcaaccacagttgtgaccccaacctgcaggtgtacaacgtcttcatagac
aaccttgacgagcggctgccccgcatcgctttctttgccacaagaaccatccgggcaggc
gaggagctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgc
atggattccaactttggcctggctgggctccctggctcccctaagaagcgggtccgtatt
gagtgcaagtgtgggactgagtcctgccgcaaatacctcttctag

DBGET integrated database retrieval system