KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108517467Help
Entry
108517467         CDS       T04641                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rbb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108517467 (SUV39H1)
Enzymes [BR:rbb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108517467 (SUV39H1)
Chromosome [BR:rbb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108517467 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108517467 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 414 aa AA seqDB search
MELGERGPGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQE
YYLVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYL
VQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVA
VGCECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQ
KGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYL
FDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAG
EELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggagctcggggagcgcgggcctggctgcagcgtatgttgcaagtcttcttggaatcag
ctgcaggacctgtgccgcctggccaagctctcctgccctgccctcggtatctctaagagg
aacctctatgactttgaagtcgagtacctgtgcgattacaagaagatccgcgaacaggaa
tattacctggtgaaatggcgcggatatccagactcagagagcacctgggagccacggcag
aatctcaagtgtgtgcgtatcctcaagcagttccacaaggacttagagagggagctgctc
cggcggcaccaccggtcaaagaccccccggcacctggacccaagcttggccaactacctg
gtgcagaaggccaagcagaggcgggcactccgtcgctgggagcaggagctcaatgccaag
cgcagccatctgggacgcatcactgtagagaatgaggtggacctggacggccccccgcgg
gccttcgtgtacatcaatgagtaccgtgttggtgagggcatcaccctcaaccaggtggct
gtaggctgcgagtgccaggactgtctgtgggcacccactggaggctgctgcccgggggcg
tcactgcacaagtttgcctacaatgaccagggccaggtgcggcttcgagccgggctgccc
atctacgagtgcaactcccgctgccgctgtggctatgactgcccgaatcgcgtggtacag
aaaggcatccgatatgacctctgcatcttccgcacagatgatgggcgtggctggggcgtc
cgcaccctggagaagattcgcaagaacagcttcgtcatggagtacgtgggagagatcatt
acctcagaggaggcggagcgacggggccagatctacgaccgccagggtgccacctacctc
tttgacctggactacgtggaggacgtgtacaccgtggatgccgcctactatggcaacatc
tcccactttgtcaaccacagttgtgaccccaacctgcaggtgtacaacgtcttcatagac
aaccttgacgagcggctgccccgcatcgctttctttgccacaagaaccatccgggcaggc
gaggagctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgc
atggattccaactttggcctggctgggctccctggctcccctaagaagcgggtccgtatt
gagtgcaagtgtgggactgagtcctgccgcaaatacctcttctag

DBGET integrated database retrieval system