KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108518702Help
Entry
108518702         CDS       T04641                                 

Gene name
KMT5B
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rbb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108518702 (KMT5B)
Enzymes [BR:rbb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108518702 (KMT5B)
Chromosome [BR:rbb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108518702 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 885 aa AA seqDB search
MKWLGESKNMVVNGRRNGGKLSNDHQQNQSKLQHTGKDTLKAGKNAVERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFXKSDSFS
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKSRTLTRQSMSRIPA
SSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKNASRKLEMGNLVLKEP
KVVLYKNLPIKKDKEPEGPAQAAVASGCLTRHAAREHRQNPVRGAHSQGESSPCTYITRR
SVRTRTNLKEASDIKLEPNTLDGYKSSVTEPCPDSGEQPQPAPMVQEEELAHETAQKGEA
KCHKSDTGMSKKKSRQGKLVKQFAKIEESTPVRDSPGKDDAVPDLMGPHSDQGEHSGTVG
MPVNYTDCVPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTL
RRRHDSSSKTNDQENDGMNSSKISIKLSKDHDNDNNLYVAKLNNGFNSGSGSSSTKLKIQ
LKRDEENRGSYTEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTDDSSSSEGDEEEDD
YDDDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaaattacagcacacggggaaggacaccctg
aaggctggcaaaaatgcagtcgagaggaggtcgagcagatgtaatggtaactcgggattt
gaaggacagagtcgctatgtaccatcttctggaatgtccgccaaggaactctgtgaaaat
gatgacctagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcattttncaaaatctgacagtttttct
cacaacaaccctgtgagatttcggcctattaaaggaaggcaggaagaactaaaggaagta
attgaacgttttaagaaagatgaacacttggagaaagccttcaaatgtttgacttcaggc
gaatgggcacggcactattttctcaacaagaataaaatgcaggagaagttattcaaagaa
catgtatttatttatttgcgaatgtttgcaactgacagtggatttgaaatattgccatgt
aatagatactcatcagaacaaaatggagccaaaatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcaactctggctgggtcctgctgcatttataaaccatgattgcagacctaattgtaag
tttgtgtcaactggtcgagatacagcatgtgtgaaggctctgagagatattgaacctgga
gaagaaatttcttgttattatggagatgggttctttggagaaaataatgagttctgcgag
tgttacacttgcgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatatggactcagagaaacagataaacgtttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gatgcagataccactcaggaaaaaaacaatgcaacttctaaccgaaaatcttcagttggt
gtaaaaaagaatagcaagagcagaacgttaacgaggcaatctatgtcaagaattccagct
tcttccaactctacctcatctaagctaactcatataaataattccagggtaccaaagaaa
ctgaagaagcctgcaaagcctttactttcaaagataaaattgagaaatcattgcaagcgg
ctggagcaaaagaatgcttcaagaaaactcgaaatgggaaacttagtactgaaagagcct
aaagtagttctgtataaaaatttgcccattaaaaaagataaggagccagagggaccagcc
caagccgcagttgccagcgggtgcttgactagacatgcggcgagagaacacagacagaat
cctgtgagaggtgctcattcgcagggggagagctcgccctgcacctacataacccggcgg
tcagtgaggacaagaacaaatctgaaggaggcctctgacatcaagcttgaaccaaataca
ttggatggttataaaagcagtgtgacggaaccttgccccgacagtggggaacagccacag
ccagctcccatggtgcaggaggaagaactggctcatgagactgcgcaaaaaggggaggct
aagtgtcataagagtgacacaggcatgtccaaaaagaagtcacgacaaggaaaacttgtg
aaacagtttgcgaaaatagaggaatctactccagtgcgtgattctcctggaaaagacgat
gcggtaccagatttgatggggccccattctgaccagggcgagcacagtggcactgtgggc
atgcctgtgaactacacagactgtgttccttcacccgtcggttgttcagttgtgacatca
gatagcttcaaaacaaaagacagctttagaactgcaaaaagtaaaaagaagaggcgaatc
acaaggtatgacgcacagttaatcctagaaaataactctgggattcccaaattgactctt
cgtaggcgtcatgatagcagcagcaagacaaatgaccaagagaatgatggaatgaattct
tcaaaaataagcatcaagttaagcaaagaccatgacaacgataacaatctctatgtagca
aagcttaataatggatttaactcaggatcaggcagtagttctacaaaattaaaaatccag
ctaaaacgagatgaggaaaatagggggtcttatacagaagggcttcatgaaaatggggtg
tgctgcagtgatcctctttctctcttggagtctcgaatggaggtggatgactatagtcaa
tatgaggaagaaagtacagatgattcctcctcttctgagggcgatgaagaggaggatgac
tatgatgatgactttgaagacgattttattcctcttcctccagctaagcgattgaggtta
atagttggaaaagactctatagatattgacatttcttcaaggagaagagaagatcagtct
ttaaggcttaatgcctaa

DBGET integrated database retrieval system