KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522054Help
Entry
108522054         CDS       T04641                                 

Gene name
NEU4
Definition
(RefSeq) neuraminidase 4
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rbb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    108522054 (NEU4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    108522054 (NEU4)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     108522054 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 497 aa AA seqDB search
MMSSAAFPRWLQSMGAPHTPSRTVLFQRERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPD
DSHAHRLVLRRGTRAGGSVRWGALQVLGTAALAEHRSMNPCPVHDTGTGTIFLFFIAVLG
HTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQL
PSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAA
VDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPT
PRRPWDDGWSVGPGSPLHTPRLGPGVHEPPEEAAGDPHGGQVPGGPCSHLQPQGHGPRQP
GPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQAPLDPRSWT
EPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPAS
PELPNLGDKPQGCCWPS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctccgcagccttcccgaggtggctgcagagcatgggggcccctcatacccct
tcacggacagtgctcttccagcgagagaggaccggcctgacctaccgcgtgccctcgctg
ctccccgtgccccccgggcccaccctgctggcctttgtggagcagcggctcagccccgac
gactcccacgcccaccgcctggtgctgaggaggggcacacgggcggggggctctgtgcgg
tggggcgccctgcaggtgctggggacagcggccctggcagagcaccggtccatgaacccc
tgccccgtgcacgacactggcacaggcaccatcttcctcttcttcatcgcggtgctgggc
cacacgcccgaggctgtgcagattgccacgggaagaaacgctgcacgcctctgctgtgtg
gccagccgtgacgccggtctctcgtggggcagtgcccgggacctcaccgaggaggccatc
ggtggtgccgtgcaggactgggccacgttcgccgtgggtcccggccatggcgtgcagctg
ccctcaggccgcctgctggtgcccgcctacacctaccgcgtggaccgccgagagtgtttt
ggcaagatctgccggaccagtccccactccttcgccttctacagcgatgaccacggccgc
acctggcgctgtggaggcctcgtgcccaacctgcgctcaggcgagtgccagctggcggca
gtggatggtggacaggccggcagcttcctctactgcaatgcccggagccccctgggcagc
cgcgtgcaggcactcagcactgacgagggcacctccttcctgcccgcagagcgcgtggct
tccctgcctgagacggcctggggctgccagggcagcatcgtgggcttcccagcccccacc
cccaggaggccatgggatgacggttggtcagtgggccctgggagtcccctccacactcca
cgccttggtcctggggtccatgaacccccagaggaggctgctggagacccccatggaggc
caggtgcctggtgggccctgcagccatctgcagcctcaggggcacggccccaggcagcct
ggccccaggcctggggtcagtggggatgtggggtcctggaccctagcgctccccatgccc
tttgctgccccgccccagagccccacgtggctgctgtactcccacccagtggggcgcagg
gctcggctgcacatgggtatccggctgagccaggccccgctggacccgcgcagctggaca
gagccctgggtgatctacgagggccccagtggctactccgacctggcgtccattgggccg
gcccctgaggggggcctggttttcgcctgcctgtacgagagtggggccaggacctcctac
gatgagatttccttttgcacattctccctacgtgaggtcctggagaacgtgcccgccagc
cccgagctgcccaaccttggggacaagcctcaggggtgctgctggccctcctga

DBGET integrated database retrieval system