KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522276Help
Entry
108522276         CDS       T04641                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00250  Alanine, aspartate and glutamate metabolism
rbb00410  beta-Alanine metabolism
rbb00430  Taurine and hypotaurine metabolism
rbb00650  Butanoate metabolism
rbb01100  Metabolic pathways
rbb04727  GABAergic synapse
rbb04940  Type I diabetes mellitus
Module
rbb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rbb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    108522276 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108522276 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108522276 (GAD1)
   00430 Taurine and hypotaurine metabolism
    108522276 (GAD1)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    108522276 (GAD1)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    108522276 (GAD1)
Enzymes [BR:rbb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108522276 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 108522276
NCBI-ProteinID: XP_017717860
LinkDB All DBs
Position
Un
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDGDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccatcttcgtctgcaacctcctcgaacgcgggagcggaccccaat
accactaacctgcgccccacaacgtacgatacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcctgcaaaggaccaacagcctggaagagaag
agtcgccttgtgagtgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagcgacggggatgcccgcttccggcgcacagagacggacttctccaacctgtttgct
agagatctgcttccggctaagaacggggaggagcaaactgtgcaattcctcctggaagtg
gtggacatactcctcaactatgtccgcaagacatttgatcgctccaccaaggtgctggac
ttccatcacccacaccagttgctggaaggcatggagggcttcaacttggagctctctgac
caccccgagtccctggagcagatcctggttgactgcagagacaccttgaagtatggggtt
cgcacaggtcatcctcgatttttcaaccagctctccactggattggatatcattggccta
gctggagaatggctgacatcaacagccaataccaatatgtttacatatgaaattgcacca
gtgtttgtcctcatggaacaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggcgccatatccaacatgtacagcatc
atggctgctcgctacaagtacttcccggaagttaagacaaagggcatggcggctgtgccc
aaactggtactcttcacctcagaacacagtcactattccataaagaaagctggggctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaaaataatt
ccagctgattttgaggcaaaaattcttgaagccaaacagaagggatatgttcccttttat
gtcaatgcaactgctggcacaactgtttatggagcttttgatccgatacaagagatcgca
gatatatgtgagaaatacaacctttggctgcatgtagatgctgcctggggaggtgggctg
ctcatgtccaggaagcaccgccataaactcaatggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggtgtgctgttgcagtgctctgccattctcgtcaaagaa
aagggtatactccaaggatgcaaccagatgtgtgcaggataccttttccagccagacaag
cagtatgatgtctcctacgacactggggacaaggcaattcagtgtggccgccacgtggat
atcttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaaccagatc
aacaaatgcctggaactggctgaatacctctacgccaagattaaaaacagagaagaattt
gagatggttttcgatggtgagcctgagcacacaaacgtctgtttttggtatattccacaa
agcctcaggggtgtgccggacagccctcaacgacgggaaaagctacacaaggtggctcca
aaaatcaaagccctgatgatggagtcaggcacgaccatggttggctaccagccccagggg
gacaaggccaacttcttccggatggtcatctctaacccagccgctacccagtctgacatt
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system