KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108526176Help
Entry
108526176         CDS       T04641                                 

Definition
(RefSeq) trypsin-2
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:rbb00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108526176
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    108526176
   04974 Protein digestion and absorption
    108526176
 Human Diseases
  Infectious diseases
   05164 Influenza A
    108526176
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     108526176
Peptidases [BR:rbb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108526176
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108526176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 261 aa AA seqDB search
MHMRETNIFTLKKGKSVPLVFHPPDALIAAPFDDDDKIVGGYTCEENSVPYQVSLNSGYH
FCGGSLINEQWVVSAAHCYKTRIQVRLGEHNIEVLEGTEQFINAAKIIRHPNYNRITLDN
DILLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSSGADYPDELQCLDAPVL
TQAECEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVSNGQLQGIVSWGYGCAQKNRP
GVYTKVYNYVDWIRDTIAANS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgagagagacaaatatcttcacattgaagaaggggaagagtgtgccattggtt
ttccatcctccagatgcactgattgctgccccttttgacgatgatgacaagatcgttggg
ggctacacctgtgaggagaattctgtcccctaccaggtgtctctgaattctggctaccac
ttctgtggtggctccctcatcaacgaacagtgggtggtgtcagcagctcactgctacaag
acccgcatccaggtgagactgggagagcacaacatcgaagtcctggagggaactgagcag
ttcatcaatgcagccaagatcatccgccaccccaattataacaggattactctggacaac
gacatcctgctgatcaagctctcctcacctgccgtcatcaatgcccgcgtgtccaccatc
tctctgcccaccgcccctccagctgctggcaccgagtgcctcatctctggctggggcaac
actctgagctctggcgccgactacccagatgagctgcagtgcctggacgcacctgtgctg
acccaggctgagtgtgaagcctcctaccctggaaagattaccagcaacatgttctgtgtg
ggcttcctcgagggaggcaaggattcctgccagggtgactctggtggccctgtggtctcc
aacggacagctccaaggaattgtctcctggggctatggctgtgcccagaagaacaggccc
ggagtctacaccaaggtctacaactatgtggactggattagggacaccatagctgccaac
agctaa

DBGET integrated database retrieval system