KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530731Help
Entry
108530731         CDS       T04641                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rbb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108530731 (SETDB2)
Enzymes [BR:rbb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108530731 (SETDB2)
Chromosome [BR:rbb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108530731 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108530731 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 718 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
IINSSTSIKGASQKEVNTQSTDHMPVTQKEQENKSNAFPSTSYGNSFPEDCTFLTENKEI
LSLEDKVVDFREKDSSLNLSYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKTN
SHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLARNYPKQKEVV
SDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPRTYYLTNFSSMFTDSCDCSEGCID
ITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQLCQNRVV
QHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTEKSNGIDENGKDENT
MKNIFSKKRKLEVACSDCEVEVLPLGLETHPRTAKTEKCSPKFSNNPKELTMETKYDNTS
RIRYHSVIGDPESKTAIFQHNGEKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSS
SNHVDDFEDNLLTESDVIDITKCREETPPRSRCNQATTLDNQNIKKAIEVQIQKPQEGRS
TACQKQQVFCDEELLSETKNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQ
NVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggcgatgcaaaaactttctggatggagctagaagatgatggaaaa
gtggacttcatttttgaacaagtacaaaatgtgctgcagtcactgaaacaaaagatcaaa
gatgggtctgccaccaataaagaatacatccaagcaatgattctagtgaatgaagcaact
ataattaacagttcaacatcaataaagggagcatcacagaaagaagtgaatacccaaagc
actgatcatatgcctgtgactcagaaggaacaggaaaacaaatccaatgcatttccctct
acatcatatggaaactcctttccagaagactgtacatttctaacggaaaataaggaaatt
ctctctcttgaagataaagttgtagactttagagaaaaagactcatctttgaatttatct
taccaaagtcatgactgctctggtgcttgtctgatgaaaatgccactgaacttgaaggga
gaaaaccctctgcagttgccaatcaaatgtcacttccaaagacgacatgccaagacaaac
tctcattcttcagcactccatgtgagttataaaaccccttgtggaaggagtctacgaaac
gtggaggaagtttttcgttacctgcttgagacagagtgtaactttttatttacagataac
ttttctttcaatacctatgttcagttggctcggaattacccaaagcaaaaagaagttgtt
tctgatgtggatattagcaatggagtggaatcagtgcccatttctttctgtaatgaaatt
gacagtagaaagcttccacagtttaagtacagaaagactgtgtggcctcgaacatattat
ctaaccaacttttccagcatgtttactgattcctgtgactgctctgagggctgcatagac
ataacaaaatgtgcatgtcttcaattgacagcaaggaatgccaaaacttcccccttgtca
agtgacaaaataaccactggatataaatataaaagactacagagacagattcctactggc
atttatgaatgcagcctgttgtgcaaatgtaatcgacagttgtgtcagaaccgagttgtc
caacatggtcctcaagtgaggctacaggtgttcaaaactgagcagaagggatggggtgta
cgctgcctagatgacattgacagagggacgtttgtttgcatttattcaggaagattacta
agcagagctaacacggaaaaatctaatggtattgatgaaaatgggaaagatgagaatact
atgaaaaatatattttcaaaaaagaggaaattagaagttgcgtgttcagattgtgaagtt
gaagttctcccattaggattggaaacacatcctagaactgctaaaactgagaaatgttca
ccaaagttcagtaataatcccaaggagcttactatggaaacgaaatatgataatacttca
agaattcggtatcattcagttattggagatcctgaatccaagacagccatttttcaacac
aatggggaaaaaatggaatttgtttcctcggagtctgtcactccagaagataatgatgga
tttaaaccaccccgagagcatctgaactctaaaaccaagggagcacaaaaggactcaagt
tcaaaccatgttgatgattttgaagataatctgctgactgaatcagatgtgatagatata
actaaatgtagagaagaaactccaccaaggagcagatgtaaccaggcgaccacattggat
aatcagaatattaaaaaggcaattgaggttcaaatacagaaaccccaagagggacgatct
acagcatgtcaaaaacagcaggtcttttgtgatgaagagttgctaagtgaaaccaagaat
acttcatctgattctctaacaaagttcaacaaagggaatgtgtttttattggatgccaca
aaagaaggaaatgtcggccgcttccttaatcatagttgttgcccaaatctcttggtacag
aatgtttttgtagaaacacacaacaggaattttccactggtggcattcttcaccaacagg
tatgtgaaagcaagaacagagctaacatgggattatggttatgaagctgggactgtgcct
gagaaggaaatcttctgccaatgtggggttaataaatgtagaaaaaaaatattataa

DBGET integrated database retrieval system