KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108536285Help
Entry
108536285         CDS       T04641                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    108536285
   04614 Renin-angiotensin system
    108536285
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    108536285
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    108536285
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     108536285
Peptidases [BR:rbb01002]
 Metallo Peptidases
  Family M2
   108536285
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108536285
CD molecules [BR:rbb04090]
 Proteins
  108536285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1160 aa AA seqDB search
MSRIYSTAKVCLPNKTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYED
FTALSNEAYKQDGFSDTGAYWRSWYNSPTFEDDLEHLYQQLEPLYLNLHAFVRRALHRRY
GDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPFPDKPNLDVTSTMLQQGWNATHMFRVA
EEFFTSLELSPMPPEFWEGSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLS
TVHHEMGHIQYYLQYKDLPVSLRGGANPGFHEAIGDVLALSVSTPAHLHKIGLLDRVTND
TESDINYLLKMALEKIAFLPFGYLVDQWRWGVFNGRTPPSHYNFDWWYLRTKYQGICPPV
TRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEAGYEGPLHQCDIYQSTKAG
AKLRKVLQAGSSRPWQEVLKDMVGSDALDAQPLLNYFQPVTQWLQEQNRQNGEVLGWPEY
QWRPPLPDNYPEGIDLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKIL
LQKNMQIANHTLKYGTQARRFDVNHFQNTTIKRIIKKVQDLERAALPAQELEEYNKILLD
METTYSVATVCRTNGSCLQLEPDLTNVMATSRKYEELLWAWEGWRDKAGRAIVQFYPKYV
ELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGA
QHVNLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDPTEAMLKQGWTPRRMFKEADD
FFTSLGLLPVPPEFWNKSMLEKPADGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVA
HHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSHE
HDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPR
TQGDFDPGAKFHIPSSVPYIRYFISFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQR
LATAMKLGFSRPWPEAMQLITGQPNMSASAILSYFKPLLDWLRTENELHGEKLGWPQYNW
TPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHQ
SLRQHPQGPQFGSEVELRHS
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggatctactccaccgccaaggtctgcctccccaacaagactgccacctgctgg
tccctggacccagacctcaccaacatcctggcttcctcgcgaagctacgccatgctcctg
tttgcctgggagggctggcacaacgccgcgggcatcccgctgaaaccgctgtacgaggac
ttcactgccctcagcaatgaagcctacaagcaggacggcttctcagacacgggggcctac
tggcgctcctggtacaactcccccacttttgaggacgatctggagcacctctatcaacag
ctagagcccctctacctgaacctccatgcctttgtccgccgtgcactgcatcgccgatat
ggggacagatacatcaacctcaggggacccatccctgctcatctgctgggagacatgtgg
gcccagagctgggaaaacatctacgacatggtggtgcctttcccagacaagcccaacctt
gatgtcaccagtactatgctgcagcagggctggaatgccacgcacatgttccgggtggca
gaggagttcttcacctccctggagctctcccccatgcctcccgagttctgggaagggtcg
atgctggagaagccggccgacgggcgggaggtggtgtgccacgcctcggcttgggacttc
tacaacaggaaagacttcaggatcaagcaatgcacacgggtcacgatggaccagctctct
acagtgcaccacgagatgggccatatacagtactacctgcaatacaaggacctgcccgtc
tccctgcgcgggggggccaaccccggcttccatgaggccattggggacgtgctggcactc
tcggtctccactcctgcacatctgcacaaaatcggcctgctggaccgtgtcaccaatgac
acggaaagtgacatcaattacttgctaaagatggcactggaaaaaattgccttcctgccc
tttggctacctggtggaccagtggcgctggggggtctttaatgggcgtactcccccttcc
cactacaacttcgactggtggtatcttcgaaccaagtatcaggggatctgtcctcctgtt
acccgaaacgaaacccactttgatgctggagctaagtttcatgttccaaatgtgacacca
tacatcaggtactttgtgagttttgtcctgcagttccagttccatgaagccctgtgcaag
gaggcaggctatgagggcccactgcaccaatgtgacatctaccagtccaccaaggcaggg
gccaagctccggaaggtgctgcaggctggctcctccaggccctggcaggaggtgctgaag
gacatggtcggctcagatgccctggacgcccagccactgctcaactacttccagccggtc
acccagtggctgcaggagcagaaccggcagaacggcgaggtcctgggctggcctgagtac
cagtggcgcccaccgttgcctgacaactacccggagggcatcgacctggtgaccgatgag
gctgaggccagcaagttcgtggaggaatatgaccggacatcccaggtggtgtggaacgag
tatgccgaggccaactggaactacaacaccaacattaccacagagaccagcaagattctg
ctgcagaagaacatgcaaatagccaaccatactctgaagtacggcacccaggccaggagg
tttgatgtgaaccacttccagaacaccactatcaagcggatcataaagaaggttcaggac
ctagaacgggcagcgctgcctgcccaggagctggaggagtataacaagatcctgttggac
atggaaaccacctacagcgtggccactgtgtgccgcacgaatggcagctgcctgcagctg
gagccagatctgacaaatgtgatggccacgtcccggaaatatgaagaactgttgtgggca
tgggagggctggcgagacaaggctgggagagccatcgtccagttttacccaaaatatgtg
gaactgatcaaccaggctgcccggctcaatggctatgtagatgccggggactcgtggagg
tctatgtacgagacaccatccctggagcaagacctggagcggctcttccaggagctgcag
ccgctgtacctgaacctgcatgcctacgtgcgccgggccctgcaccgccactacggggcc
cagcacgtcaatctggaggggcccatccctgctcacctgctggggaacatgtgggcgcag
acctggtccaacatctatgacttggtggtgcccttcccttcagccccctcgatggacccc
acggaggccatgctaaagcagggctggacgccccggaggatgtttaaggaggctgatgat
ttcttcacctccctggggctgcttcccgtgcctcctgagttctggaacaagtcgatgctg
gagaagccagctgacgggcgagaggtggtctgccacgcctcggcctgggacttctacaac
ggcaaggacttccggatcaagcagtgcactaccgtgaacttggaggacctggtggtggcc
caccacgaaatgggccacatccagtatttcatgcagtacaaagacttgcctgtggccttg
agggagggtgccaaccccggcttccatgaggccattggggacgtgctagccctctcagtg
tctacgcccaagcacctgcacagtctgaacctgctgagcagtgagggtggcagccacgag
cacgatatcaactttctgatgaagatggcgcttgacaagatcgcctttatccccttcagc
tatcttgttgatcagtggcgctggagggtgtttgacggaagcatcaccaaggagaactat
aaccaggagtggtggagcctcaggctgaagtaccagggcctctgccccccggtgcccagg
actcaaggtgactttgacccaggggccaagttccacattccttctagcgtgccttacatc
aggtacttcatcagcttcatcatccagttccagttccacgaagcactgtgccaggcagct
ggccacacgggccccctgcacaagtgtgacatctaccagtccaaggaggcagggcagcgc
ctggcgacggccatgaagctgggcttcagtaggccgtggccagaagccatgcagctgatc
acgggccagcccaatatgagcgcctcggccatcctgagctacttcaagccgctgctggac
tggctccgcacagagaatgagctgcacggggagaagctgggctggccacagtacaactgg
acaccgaactccgctcgctcagaagggcccctcccagacagcggccgcgtcagcttcctg
ggcctggacctggatgcacagcaggcccgcgtgggccagtggctgctgctcttcctgggc
atcgccctgctggtagccaccctgggcctcagccagcggctcttcagcatccgccaccaa
agcctccgccagcacccccaggggccccagttcggctctgaggtggagctgagacactcc
tga

DBGET integrated database retrieval system