KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540940Help
Entry
108540940         CDS       T04641                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
Enzymes [BR:rbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108540940 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 833 aa AA seqDB search
MEGFWVSWLGLPGLRSHPHPPLLTGMMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDRRF
RRGGGGRSFWARCCGCCSCRNVADDDWGPEPSDSRGRGSSSGTRRPGSRGSGVNAAGDGT
IREGMLVVTGVDLLSSRSDQNRQEHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRIT
LELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVTKASGQTLNLRVHTSPNAIIGKFQFTV
RTQSDAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIG
ERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSG
DYSRGTNPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSA
HDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQE
TSSGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIG
TLIVTKAIGSNMREDITYLYKHPEGSDAERKAVETATAHGSKPNVYANRGSAEDVAMQVE
AQDAVMGQDLMVSVMLTNHSSSRRTVKLHLYLSVTFYTGVTGTIFKETKKEVELAPGASD
RVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVG
QECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPR
QLIASLDSPQLSQVHGVIQVDVAPAPGARGFFSDAGGDSHLGETIPMASRGGA
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggagggtttctgggtcagctggctggggctacctgggttaaggagccacccccacccc
cccctcctaacaggcatgatggacgggccacgttccgacgttggccgttggggtggcaac
cccttgcagccccctaccacgccttctccagagccagagccagagccagacagacgcttt
cgcagaggaggaggaggccgttccttctgggctcgctgctgtggctgctgttcatgccga
aatgtggcagatgacgactggggacctgaaccctctgactccaggggtcgagggtccagc
tctgggactcgaagacctggctcccggggcagtggtgtcaatgcagctggagatggcacc
atccgagagggcatgctagtagtgaccggtgtggacttgctgagctcacgctcggaccag
aaccgccaagagcaccacacagacgagtatgaatacgatgagctgatagtacgtcgcggg
cagcctttccacatgcttctccttctgtcccggacctatgaatcctctgatcgcatcacc
cttgagttactcatcggaaacaaccccgaggtgggcaagggcacgcatgtgatcatccca
gtgggcaaggggggcagtggaggctggaaagcccaggtgaccaaggccagtgggcagact
ctgaacctacgggtccacacttcccccaacgccatcatcggcaagtttcagttcacagtc
cgcacacagtcagacgctggggagttccagttgccctttgaccctcgcaacgagatctac
atccttttcaacccctggtgcccagaggacattgtgtacgtggaccatgaggattggcgg
caggagtatgtgcttaatgagtctgggagaatttactatgggaccgaagcacagattggc
gagcggacgtggaactacggccagtttgaccatggggtgctggatgcctgcctatacatc
ctggaccggcgggggatgccatatggaggccgtggagacccagtcagtgtctcccgggtc
atctctgccatggtgaactccctggatgacaatggagtcctgattgggaactggtctggt
gattactcccgaggcaccaacccatcagcgtgggtgggcagcgtggagatcctgcttagc
tatctacgcaccggctattccgtcccatatggccagtgctgggtctttgctggcgtgacc
actacagtgctgcgctgcctgggtctggccacccgtactgtcaccaacttcaactccgcc
catgacacagacacatcccttaccatggacatctacttcgatgagaacatgaagccccta
gagcacctgaaccatgattctgtctggaacttccatgtgtggaacgactgttggatgaag
aggccagatcttccctcgggcttcgatgggtggcaggtggtggatgccacaccccaggag
actagcagtggcatcttctgctgtggcccctgctccgtggagtccatcaagaatggcctg
gtctacatgaagtatgacacgcctttcatttttgctgaggtgaatagtgacaaggtgtac
tggcagcggcaggacgatggcagcttcaagattgtgtatgtggaggagaaggccatcggc
acactcattgtcacaaaggccattggctccaacatgcgggaggacatcacctacctctat
aagcacccagaaggttcagatgcggagcggaaggcagtagagacagcaacagcccacggc
agcaaacccaatgtgtacgccaaccggggctcagcggaggatgtggccatgcaggtggag
gcacaggacgcggtgatggggcaggatctgatggtctcggtcatgctgaccaatcacagc
agcagccgccgcacagtgaaactgcacctctacctctcagtcaccttctataccggtgtc
actgggaccatcttcaaggaaaccaagaaggaagtggagctggcaccaggggcctcggac
cgtgtgaccatgccagtggcctacaaggaataccggccccacctcgtggaccaaggggcc
atgctgctgaacgtctcaggccacgtcaaggagagcgggcaggtgctggccaagcagcac
accttccgtctgcgtaccccagacctctccctcacgttactgggagcagcagtggttggc
caggagtgtgaagtacagattgtcttcaagaacccccttcccgtcaccctcaccaatgtc
gtcttccggctcgagggctctgggttacagaggcccaagatccttaacgttggggacatc
ggaggcaatgaaacagtgacactgcgccagacgtttgtgcctgtgcgaccaggcccccgc
cagctcattgccagcttggacagcccgcagctctcccaggtgcatggtgtcatccaggtg
gatgtggccccagcccctggggccaggggcttcttctcagatgctggaggtgacagtcac
ttgggagagaccatccctatggcatctcgaggtggagcttag

DBGET integrated database retrieval system