KEGG   Mucinivorans hirudinis: BN938_1113Help
Entry
BN938_1113        CDS       T03205                                 

Definition
(GenBank) Glycogen phosphorylase
Organism
rbc  Mucinivorans hirudinis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn DUF3417 Phosphorylase Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 PSII_Pbs27
Motif
Other DBs
NCBI-ProteinID: CDN31208
UniProt: A0A060RBP7
LinkDB All DBs
Position
complement(1099140..1103405)
Genome map
AA seq 1421 aa AA seqDB search
MNENLPENGGYLFEVSWEVCNKVGGIHTVVGTKALTAISRYGDNYICIGPDFTSETKNIE
FEEDPTLFRQWHQIAYNEGLRVRVGRWKVVKGNPIVILVDYSSFISQKDSILANFWEDYG
VDSISGGWDYIEPFLFGYATAKVIENFKLHNIHTCESVIAHFHEWMTASGGLFIKKYVPG
VATVFTTHATVAGRCIAGNGLPLYGNMAGYNGDEIARRFGVMAKHSIEKAAAHNYDVFAT
VSELTARECEILLSKRPNQVTPNGFEKDFVPKGGEYDKKREQARATMINVAEVALDVKFE
REPMIVAIGGRYEFKNKGIDEFIDAMAELNNSEEFVGEILAYIMVPSWNHGARGDLRRKL
ANPTTCVNDYGHIANSTHYLGDPDNDPVINHLRRHNLLGVSKKVKVIFVPCYLNGDDGIF
NKSYYDLLIGADVSVFPSYYEPWGYTPLESIAFGVPTITTDLAGFGIWVKEFATKENCGV
TVIHRDDYNYQQVTVDISKTLLAYANQPKGGMEAARLAAQATSDIALWSNLFSNYEKVYT
MAKEKVAERQGEFITDGGEVHEQVNYVSQQLLPGNHPNWTRIMVERAIPEELHKLELLSK
NLWWSWNESARQLFESLDPEMWNVVERNPIAQLDHLSLKTLREFAQDKIFLARMDSVYEE
FETYMAQKGKGSGPKIAYFSMEYGLHASLKIYSGGLGILAGDYLKESSDKNVPMTAVGLL
YRYGYFTQRLSNAGDQEAGYEAQNFDKLPITAVRDEQGNWKTITVNFPGRTVTARIWRCD
VGRTELYLLDTDHDLNLPEDRSITYHLYGGDWDNRLKQELLLGIGGIRAMETLGVKSDVY
HCNEGHAAFIGLERAKNFIYENELSFSEALEAVRSSSLFTTHTPVPAGHDAFDEGMIRQY
MSHYPERLKITWEQFINLGKTNPHDPSEKFSMSVLAANLSQEVNGVSWLHGEVSKDIMAN
MWPGYFPCESHIGYVTNGVHFPTWAASRLKSVYHKYLGDAFFKGDYSKANWDKVYDIPDE
LLWDSRLYLKQRLMKLIRRRVADPAQFRFDSPRQLVQIQEALKGDVLTIGFARRFATYKR
AHLLFTNLERLAAIVNNSERPVQFVFAGKAHPADKAGQDLIRRIVEVSKMPQFLGKIIFL
QNYDMELARRMVQGVDIWLNTPTRPLEASGTSGEKAVMNGVMHFSVLDGWWVEGYKEGAG
WMLPQEGTFTDQRYQDELDAEMVYSTIEEQIAPQYYARNSKGLSHEWVATIKRCIAEVAS
DFTTNRMMQDYEDRFYSKLYERHTAMVAGNFAMAREIASWKRNVSRRWDNVNILEVKTFD
LSKEAFLMGQHYNLEVTLDIDGLKPEDIGVEIITADQITDYNKVVIRHKYQFEPVSVEGN
IVKYRLENAPEITGTFDTAIRVYAHNCKLPHRQDFALVKWA
NT seq 4266 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaatctacctgaaaatgggggctaccttttcgaagtgagttgggaggtgtgt
aacaaagtcggtggtattcacactgttgtcggcacaaaggctctcacggcaatctcccgc
tatggtgacaattatatctgtatcggacccgactttacatcggaaaccaagaatatcgag
ttcgaggaagatccaaccctatttcgacagtggcatcagattgcctataacgagggattg
agggtgagggtagggcgatggaaagtggtaaaaggcaatccgatagttattttggtggat
tacagctcgtttatctctcaaaaggactctattttagcaaatttttgggaggattacgga
gtggattcaatcagtggaggatgggattacatagaaccgtttctctttggttacgcaacg
gctaaggttatagagaattttaagctccacaacattcacacctgcgagagtgtaatagca
cacttccacgagtggatgacagccagcggcggactcttcatcaagaagtatgtgccgggt
gtggctacggtcttcacaacgcacgctaccgtagcggggcgttgcatagcgggtaacgga
ctgcctctgtatggcaatatggcgggatataacggagatgagatagcacgccgattcggg
gttatggcaaaacactccatcgagaaggcagctgcccacaactacgatgtctttgcaacg
gtcagcgaattgacagcgcgcgagtgcgaaatcttgctatctaaaagaccgaaccaagta
acgcctaatggcttcgagaaagattttgtgcccaaaggcggtgagtatgataaaaaacgc
gagcaggcacgcgccacgatgataaatgttgcagaggtggcactcgacgtgaagttcgag
cgtgagccgatgattgttgctatcggcggacgatatgagtttaagaataaggggattgat
gagtttattgatgcaatggcagagctcaacaattctgaggagttcgtcggcgagattctg
gcatacattatggtacccagttggaatcacggtgctcgaggtgatcttcgtcgcaagttg
gcaaacccaacaacctgtgtgaacgactacgggcacatagccaattcgacacactacctc
ggcgaccccgacaacgaccctgttatcaaccacttgcgccgacacaatctgctgggagtg
tcaaagaaagtaaaagttattttcgtgccctgctatctgaacggcgatgatgggatattt
aataagagctactacgatttattgattggtgcggacgtttcagtatttccgtcttactat
gagccttggggctacactccgttggaatccatcgcttttggtgtgcccacgattaccact
gacttggcaggatttgggatttgggtcaaagagttcgccactaaggaaaattgcggagtt
accgtcatccatcgcgatgactacaattaccagcaggtaacggtagatatttcaaaaaca
ttgctcgcctacgcaaaccaacccaaggggggtatggaggcggcgcgtcttgcggcacaa
gctacttcggatatagccctgtggagcaatctgtttagtaattacgaaaaagtatataca
atggcaaaagaaaaagtcgcagaacgtcagggtgaatttatcaccgatggcggcgaagta
cacgaacaggtgaactatgtgagtcagcagctgctgccgggaaaccaccccaactggacg
cggattatggtcgaaagagccatacccgaagagttgcataagttggagttgttgagcaaa
aacctttggtggtcttggaatgagtccgcacgccaactattcgagtcattggaccccgag
atgtggaatgtagtggaacgaaatccaatcgcccagttagaccatctaagcctcaaaaca
ctccgcgagtttgctcaggacaagatatttcttgcacgaatggactctgtttatgaggag
tttgaaacatatatggctcagaagggtaagggtagtggtcccaagattgcatacttctct
atggagtacggcttgcacgcctctctgaaaatatattcgggcggtctgggcatcttggca
ggtgactatttgaaggagagctcggacaaaaatgtgccgatgacagcagtgggtctgctc
tatcgctacggctatttcactcaacgtctgagcaacgccggcgaccaagaagcaggctac
gaggctcaaaacttcgacaaactccccatcaccgccgtgcgcgatgagcagggcaattgg
aagaccatcaccgtaaacttccccgggcgtacggtaacggcgcgtatttggcgttgcgat
gttgggcggacagagctatatctacttgacacagaccacgatttgaacctacccgaagac
cgttcaatcacataccacctctatggcggtgattgggacaaccgcctcaaacaagagctt
ttgctgggcattggcggtatccgcgctatggagacgctgggcgtgaagtcggacgtatac
cactgtaatgagggacacgcggcatttatcggtctggaacgtgccaagaattttatttat
gagaacgagttatcattctcagaggcattggaggcagtgcgtagctcgtcgctatttacc
actcacacacccgttccggcgggacacgatgccttcgacgagggtatgattcgtcagtat
atgtctcactatcccgagcgtttgaagattacttgggaacaattcataaatctgggcaag
accaatccacacgacccgtcagagaaattctcgatgagcgtattggctgccaacctctca
caggaggtgaacggcgtgagctggttgcacggggaggtgagtaaggatattatggcaaat
atgtggcccggctactttccctgcgaatcgcacatcgggtacgtaaccaatggtgttcac
ttcccaacgtgggcagcaagccgactcaaatcggtgtatcacaaatatttgggtgatgct
ttctttaagggcgattatagcaaggctaattgggacaaggtgtatgatattccggatgag
ttgctttgggactcacgactttatctgaagcagcgtctaatgaagctcattcgccgccgc
gtggcagaccctgcacagttccgttttgactctccgcgccaactggtgcagattcaagag
gcattgaagggtgatgttctcaccatcggttttgcacgtcgctttgcaacctacaaacgt
gcacaccttctattcaccaacctagagcgtttggcagccatcgtaaacaattccgaacgt
cccgtacagttcgtatttgcgggtaaggctcacccggcggacaaagcgggtcaggatttg
attcgtcgcattgtcgaagtctcaaaaatgcctcaattcttgggtaagattatcttcctg
caaaactacgatatggagcttgcgcgacgtatggttcagggtgtcgatatttggttgaat
actccgacgcgtccgctggaggcatcgggtacttcgggcgaaaaggctgtgatgaatggc
gttatgcacttttcggtacttgacggatggtgggttgagggttacaaagagggtgcgggt
tggatgcttcctcaggagggcacattcaccgaccaacgctatcaggatgagttggatgcc
gaaatggtatactccaccatcgaggagcagattgcaccacaatactatgcccgcaactcg
aaagggttgtcacacgaatgggtggctacaatcaaacgttgtattgcagaggtggcttct
gactttacaaccaaccgtatgatgcaggactacgaagacagattctacagcaaactctac
gagcgccatacggctatggttgccggtaactttgcaatggcgcgcgagattgcgtcttgg
aaacgtaatgtatcgcgacgttgggataacgttaatatattggaagtaaaaacgtttgac
ctctccaaggaggctttccttatgggacagcactacaacctcgaagttacgcttgatatt
gacggtctcaaaccggaagatattggggttgagataattacagctgaccaaatcacagat
tacaacaaggttgtcatccgtcataaatatcagttcgagccggtctctgtcgagggtaac
attgtgaaatatcgtttggagaatgctcccgagattaccggtacgttcgacaccgcaatc
cgcgtgtatgcgcataactgtaaattgccgcaccgtcaggactttgccctcgttaagtgg
gcataa

DBGET integrated database retrieval system