KEGG   Mucinivorans hirudinis: BN938_1419Help
Entry
BN938_1419        CDS       T03205                                 

Definition
(GenBank) Sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
rbc  Mucinivorans hirudinis
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rbc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BN938_1419
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BN938_1419
Enzymes [BR:rbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BN938_1419
Bacterial toxins [BR:rbc02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BN938_1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1427308..1428933)
Genome map
AA seq 541 aa AA seqDB search
MKRITFTVLCIVLGICAIYGAPKTTTNIYRIPVLTLKKTNPTLEVEFITDKPTQVKEIVL
ELGGASDLRDVKSVWVGYSDGAKKFTPENSFSMAQNPHKRMVFRGDLEVKDTLYFTVFVQ
LNDEVDLLGKLTVECVGIKTNRGYQRVEGRGEYRLGVALRQRGDDGVDTYRIPGIATTNN
GTLIAVWDNRIENSRDLQGNIDIGMRRSTDAGNTWDKQVSVLDMGEWGGLPPRFNGVSDA
NVMVDKKNGTIIVSGLWMYGVINAEGVWVEGLNENSKEWNHQWSNRGSQAGFDVKQTSQF
LITTSGDDGKSWSEPVNLTRMCKQESWWLWAPAPGSGITMEDGTLVMPTQGRDSVGYPFS
NITWSKDGGKSWTTSKPAYYNTTECNVVELSHGSLMLNMRLNGNNGRGEGNGRAIAVSKD
LGKTWTEHHTSRNALIEPTCMASLHKHKYRGGTVLLFVNPNSRDRRNNMTLKASFDDGNT
WHERVVLDEFDSFGYSSITSVDQETIGILFEGSQAQMTFMKVGLDEIMMGASENPKTLTR
H
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaataacctttaccgtgctttgtatcgtgctgggcatttgtgccatttacgga
gcacccaagaccaccactaatatctaccggattccggttctcaccctcaagaagacgaat
cccactctcgaggtggaatttataaccgacaaacccacgcaggtgaaggagatagtgttg
gaattgggcggagcgtctgatttgagagatgtcaaatcggtttgggtaggatattcggac
ggggcgaagaaattcacccccgagaatagcttttcaatggcacagaacccccacaagagg
atggttttcagaggtgatttagaggtaaaggatacgctctacttcacagtttttgttcaa
ctgaacgatgaggttgatctgcttggcaaactcaccgtagagtgtgtcggcataaagacg
aaccgaggctatcagagggttgagggaaggggggagtatcgccttggcgtggctctgcgt
cagcgcggtgacgatggtgtggatacatatcgtatccccggcattgccacaaccaacaac
ggaacgcttattgcggtgtgggacaatcgtatcgaaaattcacgcgacttgcagggcaac
atcgatataggtatgcgtcgaagtacggacgctggcaacacctgggacaagcaggtgtcg
gtactcgatatgggcgagtggggtgggctacccccgagattcaatggagtgagcgatgcc
aatgttatggtggataagaagaacggcacgattatcgtttccggattgtggatgtatggg
gtgataaatgccgagggtgtttgggtcgagggactcaacgaaaactcgaaggagtggaat
caccagtggagtaatagggggtcgcaagccggctttgatgtgaagcagacaagtcaattt
ctgattaccaccagtggggatgatggaaagagttggagtgaacccgtgaatctcactcgt
atgtgtaagcaggagagttggtggctatgggcgccggcgccgggaagtggtattacaatg
gaagacggcaccttggttatgcccactcaggggcgtgattcggtgggttaccccttctcg
aatattacgtggagtaaggatggcggcaagagttggactacgagcaaaccggcgtattac
aacaccaccgagtgcaatgtggtagaactctctcacggctcactgatgctcaatatgcgc
ctcaatggcaacaacggcaggggcgagggcaatggcagggcgatagccgtttcaaaagat
ttgggcaaaacctggactgagcaccatacctcacgcaacgccttaattgaacccacctgt
atggcaagccttcataagcacaaatacaggggtggcactgtgctgttgttcgtaaatccc
aatagtcgcgaccgccgaaacaatatgaccctcaaggcgagctttgacgatggtaacacg
tggcacgagcgggtggttttggatgagttcgacagctttggctactcctcaatcacgagc
gtggaccaagagacaatcggcatacttttcgagggcagtcaggcgcagatgacctttatg
aaggttgggcttgatgagattatgatgggggcttctgagaatcccaaaacattaactcgg
cattaa

DBGET integrated database retrieval system