KEGG   Rhizobiales bacterium NRL2: TEF_06365Help
Entry
TEF_06365         CDS       T04419                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
rbm  Rhizobiales bacterium NRL2
Brite
Enzymes [BR:rbm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     TEF_06365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ANK80462
UniProt: A0A192IGP9
LinkDB All DBs
Position
1388190..1388807
Genome map
AA seq 205 aa AA seqDB search
MIELYTWGTPNGRKVSVMLEECGLDYQVYPVNIAKDEQFDPDFLKISPNNKIPAILDSDG
PGGESISVFETGAILIYLAQKTGRFLPAEPRAFQETMQWLMWQMGGVGPMMGQAHHFRRF
APEKIPYAIDRYTNETARLYGVLDKRVSERDWLAADQYTIADIATFPWIARHEWQGMELT
DFPNLKRWYDRIWARDAVKKGFEVP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaactctacacctggggtacgcccaacggtcgcaaggtctccgtgatgctggag
gaatgcgggctcgactatcaggtctatcccgtgaacatcgcgaaggacgagcagttcgat
ccggacttcctgaagatcagccccaacaacaagattccggcgatcctcgacagcgacgga
cccgggggcgaatcgatctccgtcttcgagaccggcgccatcctgatctacctggcgcag
aagaccggcagattcctgcccgccgagccgcgcgcctttcaagagaccatgcagtggctg
atgtggcagatgggcggcgtcgggccgatgatgggccaggcccaccatttccgccgcttc
gcgcccgagaagattccctacgccatcgaccgctacaccaacgagacggcgcggctctat
ggcgttctcgacaagcgggtatcggagagggattggctggcggcggaccagtacaccatc
gccgacatcgccaccttcccctggatcgcgcgtcacgaatggcagggaatggaactcacc
gactttcccaatctgaagcgctggtacgaccgcatctgggcgcgcgacgcggtgaagaag
ggcttcgaggttccctga

DBGET integrated database retrieval system