KEGG   Rhizobiales bacterium NRL2: TEF_19570Help
Entry
TEF_19570         CDS       T04419                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rbm  Rhizobiales bacterium NRL2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rbm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TEF_19570
  Amino acid metabolism
   00310 Lysine degradation
    TEF_19570
   00380 Tryptophan metabolism
    TEF_19570
Enzymes [BR:rbm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     TEF_19570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4179495..4182398
Genome map
AA seq 967 aa AA seqDB search
MGSENLAAAFLNGTNSIFIEELYEKYLEDPTSVDESWAGFFDTVGDELETVRRATDGASW
GAKNGSLEVDDPYELLGPAVKAGARTETPVDSEQARQATLDSLRALMLIRAYRVRGHLQA
TLDPLGLDQPMEHPELNPKTYGFEDKDMDRPIFLDKVLGMEAATMREILEVVQKVYCGTL
AVEYMHIQSPEQKSWIQNRIEGPDKEVTFTLMGKKAILNKIAEAEGFENFMNVKYTGTKR
FGLDGGEALMPAMEAIIKRGGQLGVQEIILGMPHRGRLNVLTNVMGKPFRAVFSEFQGNA
ANPDDVQGSGDVKYHLGTSSDREFDGNKVHLSLTANPSHLEAVDPVVLGKARAKIRQLGP
NSSHKVLPILMHGDAAFAGQGIVAECFGLSGLKGYAVGGTIHIIVNNQIGFTTSPKYSRS
SPYPSDVGKMVAAPILHVNGDDPEAVVHAAKIATEFRQEFGVDVVLDMFCYRRHGHNEGD
EPSFTQPLMYRKIASHPTTRQIYARRLVEDGVMTEEEADQMVSGFREYLEGEFEAANSFR
PNKADWLEGRWSGLSVAPLGDRRGATAVPMEKLKEIGAGLTHIPENFNAHRTIKRLMQSK
QKMFESGEGIDWATAEALAFGSLALENVPVRLSGQDSGRGTFSQRHSVLVDQVTEDRYQP
LSNIAEEQATFEVIDSMLSEAAVLGFEYGFSLAEPNALVLWEAQFGDFANGAQVIIDQFL
SNGEAKWLRMSGLVMLLPHGHEGQGPEHSSARLERYLQLCAEDNMQVANCTTPANYFHIL
RRQVHRDFRKPLILMTPKSLLRHKRCVSTLDDFSTGSSFHRVLYEETLPSDKKKAKTLIL
CSGKVYYDLVDKREELGADDAHILRIEQLYPYPTKPLVEELKPYTHVDRVIWCQEEPRNM
GAWLFVQNWLEECFQLADMKKVKRPCYVGRPPSASPATGLARVHLKEQDILCTKALKGEP
AGANPEY
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgagaatctcgcagccgctttcctgaacggcacgaactccattttcatcgag
gagctctacgagaaatatctcgaagatccgacctccgtggacgagagctgggccggcttc
ttcgacaccgtgggcgacgagctggagacggtccggcgcgccaccgacggcgcgagctgg
ggcgcgaagaacggcagcctggaggtcgacgacccctatgaactgctcggccccgcggtc
aaggcgggcgcgcgcaccgagactccggtcgattccgagcaggcccggcaggcgacgctg
gacagccttcgggccctgatgctgatccgcgcctatcgcgtgcgcggacacctgcaggcc
acgctggatccgctgggtctggaccagccgatggagcatccggagctcaatccgaagacc
tacggcttcgaagacaaggacatggaccgtccgatcttcctcgacaaggttctcggcatg
gaagccgcgaccatgcgggaaatcctggaggtcgtgcagaaagtctactgcggcaccctg
gccgtcgaatacatgcacatccagagtccggaacagaaatcctggatccagaaccgcatc
gagggcccggacaaggaagtcaccttcaccctgatgggcaagaaggcgatcctgaacaag
atcgccgaggccgagggcttcgagaacttcatgaacgtgaagtacaccggcaccaagcgc
ttcggcctggacggcggcgaggcgctgatgccggccatggaggcgatcatcaagcgcggc
ggccagctcggcgtgcaggagatcatcctcggcatgccgcaccgcggccgcctgaacgtg
ctgaccaacgtgatgggcaagccgttccgcgccgtgttctccgagttccagggcaacgcc
gccaaccccgacgacgtccagggctcgggcgacgtcaagtatcacctcggcacctcgtcc
gaccgcgagttcgacggcaacaaggtgcatctgtcgctgaccgccaacccgtcgcacctg
gaagcggtcgatccggtggtcctgggcaaggcgcgggcgaagatccgccagctcggcccc
aacagttcccacaaggtgctgccgatcctgatgcacggcgacgccgccttcgccggccag
ggcattgtcgcggagtgcttcggcctgtcgggcctgaagggctacgccgtcggcggcacg
atccatatcatcgtcaacaaccagatcggcttcacgacctcgccgaaatactcccgctcc
tcgccctatccgtccgacgtgggcaagatggtcgccgcgccgatcctgcacgtgaacggc
gacgatccggaagccgtcgtgcacgccgccaagatcgccacggagtttcgtcaggagttc
ggcgtcgacgtggtgctcgacatgttctgctatcgccgccacggccataatgagggcgac
gagccctccttcacccagccgctgatgtaccgcaagatcgcctcccacccgacgactcgc
cagatctacgcccggcggctggtcgaggacggcgtgatgaccgaggaggaagccgaccag
atggtttccggcttccgcgagtacctggaaggcgagttcgaggcggccaactccttccgg
cccaacaaggccgactggctggagggacgctggagcggcctgtccgtcgcgccgctcggc
gaccgccgcggggcgaccgcggtgccgatggagaagctgaaggagatcggcgcggggctg
acgcatatcccggagaacttcaacgcccaccgcaccatcaagcgcctgatgcagtcaaag
cagaagatgttcgagagcggcgaaggcatcgactgggccaccgccgaggcgctcgccttc
ggcagcctggcgctggagaacgtgcccgtgcggctgtcgggccaggattcaggccgcggc
accttcagccagcgccattcggtgctggtcgaccaggtgaccgaggaccgctaccagccg
ctgagcaacatcgccgaggaacaggccaccttcgaggtcatcgattccatgctctcggag
gccgcggtgctcggcttcgaatacggcttctcgctggccgagcccaacgcgctggtgttg
tgggaagcgcagttcggcgacttcgccaacggcgcccaggtgatcatcgatcagttcctc
tccaacggcgaggccaagtggctgcgcatgagcggactggtgatgctgctgccgcacggc
catgaaggccagggacccgagcacagctccgcccggctggagcgctatctgcagctctgc
gccgaggacaacatgcaggtcgcgaactgcaccacgccggctaactacttccacatcctg
cgccgccaggtgcaccgcgatttccgcaagccgctgattctgatgacgcccaagtcgctg
ctgcgccacaagcgttgcgtgtcgaccctggacgacttctcgaccggttcgtcgttccac
cgggtgctctacgaggagaccctgccgagcgacaagaagaaggcgaagaccctgatcctg
tgttccggcaaggtctattacgacctggtcgacaagcgcgaggaactgggcgccgacgac
gcccacatcctgcgcatcgagcagctctatccctacccgaccaagccgctggtcgaggaa
ctgaagccctacacgcacgtggaccgggtgatctggtgtcaggaagagccgcgcaacatg
ggggcgtggctgttcgtccagaactggctggaggaatgcttccagctggccgacatgaag
aaggtcaagcggccctgctatgtgggacgtccgccctcggcctcgcccgccaccggtctg
gcccgggtgcacctgaaagagcaggacatcctctgcaccaaggcgctcaagggcgagccc
gccggcgccaacccggaatactga

DBGET integrated database retrieval system