KEGG   Rubrivivax benzoatilyticus: RBXJA2T_10419Help
Entry
RBXJA2T_10419     CDS       T04092                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
rbn00020  Citrate cycle (TCA cycle)
rbn00480  Glutathione metabolism
rbn01100  Metabolic pathways
rbn01110  Biosynthesis of secondary metabolites
rbn01120  Microbial metabolism in diverse environments
rbn01130  Biosynthesis of antibiotics
rbn01200  Carbon metabolism
rbn01210  2-Oxocarboxylic acid metabolism
rbn01230  Biosynthesis of amino acids
Module
rbn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rbn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBXJA2T_10419
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RBXJA2T_10419
Enzymes [BR:rbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RBXJA2T_10419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: EGJ10732
UniProt: F3LQW4
LinkDB All DBs
AA seq 418 aa AA seqDB search
MYQHIKVPEGGQKITVNADFSLNVPDQPIIPYIEGDGTGFDITPVMLKVVDAAVAKSYGG
KRKIHWMEVYAGEKSTKVYGPDVWLPEETLHAVRDYVVSIKGPLTTPVGGGIRSLNVALR
QELDLYVCLRPIQYFKGVPTPLKEPEKTNMVIFRENSEDIYAGIEWEAQSDKAKKVIKFL
IEEMGVKKIRFPETSGIGIKPVSKEGTERLVRKAIQYAVDNDKPSVTIVHKGNIMKFTEG
GFRDWAYALAQREFGAQPIDGGPWCSFKNPRTGKDIVIKDSIADAFLQQILLRPAEYSVI
ATLNLNGDYVSDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEILS
AEMMLRHMGWTEAADLIISAMEKSILSKQVTYDFARLMDGATQVSCSGFGKVMIEQMG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagcacatcaaggtgcccgagggcgggcagaagatcacggtcaacgccgacttc
tcgctgaacgtccctgatcagcccatcattccgtacatcgagggcgacggcaccggcttc
gacatcacgccggtgatgctgaaggtggtcgatgcggcagtcgccaagagctacggcggc
aagcgcaagatccactggatggaggtctacgccggcgagaagtcgaccaaggtctacggc
cccgacgtctggctgcccgaggagacgctgcacgcagtgcgcgactacgtcgtgtcgatc
aagggcccgctgacgacgccggtcggtggcggcatccgcagcctgaacgtcgcgctgcgc
caggaactcgatctctacgtctgtctgcgcccgatccagtacttcaagggcgtgccgacg
ccgctgaaggagccggagaagaccaacatggtcatcttccgcgagaactccgaggacatc
tacgccggcatcgagtgggaagcccagagcgacaaggcgaagaaggtcatcaagttcctc
atcgaggaaatgggcgtcaagaagatccgtttccccgagacctcgggcatcggcatcaag
cccgtctcgaaggaagggaccgagcgcctggtgcgcaaggcgatccagtacgccgtcgac
aacgacaagcccagcgtgaccatcgtgcacaagggcaacatcatgaagttcaccgaaggt
ggcttccgcgactgggcctacgcgctggcgcagcgcgagttcggcgcccagccgatcgac
ggcggcccgtggtgctcgttcaagaacccgaggaccggcaaggacatcgtcatcaaggac
tcgatcgccgacgccttcctgcagcagatcctgctgcgcccggccgagtactcggtgatc
gcgacgctcaacctgaacggcgactacgtctccgacgcgctggcggcgcaggtcggcggc
atcggcatcgctccgggcgccaacctgtcggactcggtggcgatgttcgaggcgacgcac
ggcactgcgcccaagtacgccggcaaggactacgtcaacccgggctccgagatcctctcg
gccgagatgatgctgcgccacatgggctggaccgaggctgccgacctgatcatcagcgcg
atggagaagtccatcctgagcaagcaggtgacctacgacttcgcgcgcctgatggacggc
gcgacgcaggtctcgtgctccggcttcggcaaggtgatgatcgagcagatgggctga

DBGET integrated database retrieval system