KEGG   Rubrivivax benzoatilyticus: RBXJA2T_11021Help
Entry
RBXJA2T_11021     CDS       T04092                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rbn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RBXJA2T_11021
Enzymes [BR:rbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RBXJA2T_11021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 525 aa AA seqDB search
MKPANEDRARRWARLSETRDWDLAVVGGGATGLGVALDAAARGFSVALVESHDFAQGTSS
RATKLVHGGVRYLAQGNVNLVREALHERAAMLSNAPHIAQPLPFVMPGYHWWERGFYGTG
LKLYDALAGERGLGATEWLGSGQVRTLLPGVQPRGLWGGVKYWDGQFDDARYAVLLARTA
AARGAVVLNHCAAVALQRRDGRVQGVVVRDAETGAEATLSARCVVNAAGVWVDTLRELDR
EAGAAPRKPLVAPSQGVHLVVDRRFLPGTHALLVPKTADGRVLFAVPWLGKLILGTTDTP
REDLAREPQPFPAEVDFILRESARYLQQAPRREDVRSVWVGLRPLVRHDGEAGDTKALSR
EHTVLVSPGGLVTVTGGKWTTYRAMAEDVLDRCMAQGLLPRRPAGATARLQLVGAAPGRS
LTAPPGEHLYGSEAAALRGLPGAEHWLWRDGDGGLSEAMVRFAARHEAARTVEDVLARRS
RLLFLDAAEAGRLAGVVATILGDELERELDPAPFEALAARYTRLP
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccgccaacgaggatcgcgcgcgccgctgggcgcgcctgagcgaaacacgcgac
tgggacctggccgtcgtcggcggcggcgccaccggcctgggcgtggcgctggacgccgcg
gcgcgcggcttctcggtcgcgctcgtcgagtcgcacgacttcgcccagggcacttcgtcg
cgcgccaccaagctcgtgcacggcggcgtgcgctacctcgcgcagggcaacgtgaacctg
gtgcgcgaggcgctgcacgaacgcgcggcgatgctgtccaacgcgccgcacatcgcccag
ccgctgcctttcgtgatgcccggctaccactggtgggagcgcggcttctacggcaccggg
ctcaagctctacgacgcgctggccggcgaacgcggcctgggcgccaccgagtggctgggc
agcgggcaggtgcgcacgctgctgcccggcgtgcagccgcgcgggctgtggggcggcgtc
aagtactgggacggccagttcgacgacgcccgctacgccgtgctgctggcgcgcaccgcg
gccgcacgcggcgcggtcgtgctgaaccactgtgccgccgtcgcgctgcagcgccgcgac
ggccgcgtgcaaggcgtcgtcgtgcgcgacgccgagaccggcgccgaggcgacgctgtcg
gcgcgctgcgtcgtcaacgccgccggcgtctgggtcgacacgctgcgcgagctggaccgc
gaggccggcgccgcgccgcgcaagccgctggtcgcgccgagccagggtgtgcacctggtc
gtcgacaggcgattcctgcccggcacgcacgcgctgctggtgcccaagaccgccgacggg
cgcgtgctcttcgccgtgccctggctgggcaagctgatcctcggcacgaccgacacgccg
cgcgaggacctggcgcgcgagccgcagcccttcccggccgaggtcgacttcatcctgcgc
gagagcgcgcgctatctgcagcaggcgccgcggcgcgaggacgtgcgttcggtctgggtc
ggcctgcgcccgctggtgcgccacgacggcgaagccggcgacaccaaggcgctgtcgcgc
gagcacacggtgctggtgtcgcccggcggcctggtcaccgtcaccggcggcaagtggacg
acctaccgcgcgatggccgaggacgtgctcgaccgctgcatggcgcaaggcctgctgccg
cgccggccggccggcgcgacggcacggctgcagctcgtcggcgcggcacccgggcgctcg
ctgacggcaccgccgggtgaacacctctacggcagcgaagcggcggcgctgcgtgggctg
ccgggtgcggagcactggctctggcgcgacggcgacggcggcctcagcgaggcgatggtg
cgtttcgccgcccgccacgaggcggcgcgcacggtcgaggacgtgctggcgcggcgctcg
cggctgctgttcctggacgccgccgaggccggccgcctggccggcgtggtggccacgatc
ctcggcgacgagctggagcgtgaactcgatccggcgccgttcgaggcgctggccgcgcgc
tacacgcggctgccctga

DBGET integrated database retrieval system