KEGG   Rubrivivax benzoatilyticus: RBXJA2T_18703Help
Entry
RBXJA2T_18703     CDS       T04092                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rbn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RBXJA2T_18703
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RBXJA2T_18703
Enzymes [BR:rbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RBXJA2T_18703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 144 aa AA seqDB search
MMTNPTGRLTQGQFSFLPDLTDEEITLQIEYGLKKGYAWSVEYSDDPHPRNTYWEMYGMP
MFDLQDAAGVLMELNNCRKTFPSHYIRLMAFDSTRGVESIAMSFIVNRPSTEPGFGVVRQ
EINGRSMRYTVHSYATDKPEAQRY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaaccccaccggccggctcacgcaaggccagttcagcttcctcccggatctg
accgacgaggagatcacgctgcagatcgagtacggcctgaagaagggctacgcctggagc
gtcgagtacagcgacgacccgcatccgcgcaacacgtactgggagatgtacggcatgccg
atgttcgacctgcaggatgccgccggcgtgctgatggagctgaacaactgccgcaagacc
ttccccagccactacatccgcctgatggccttcgactccacccgtggcgtcgagtcgatc
gcgatgagcttcatcgtgaaccggccgtcgacggagcccggcttcggcgtcgtgcgccag
gagatcaacggccgctcgatgcgctacaccgtgcacagctacgcgaccgacaagcccgaa
gcgcaacgatattga

DBGET integrated database retrieval system