KEGG   Rubrivivax benzoatilyticus: RBXJA2T_18703Help
Entry
RBXJA2T_18703     CDS       T04092                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
rbn00630  Glyoxylate and dicarboxylate metabolism
rbn00710  Carbon fixation in photosynthetic organisms
rbn01100  Metabolic pathways
rbn01120  Microbial metabolism in diverse environments
rbn01200  Carbon metabolism
Module
rbn_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rbn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rbn_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rbn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RBXJA2T_18703
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RBXJA2T_18703
Enzymes [BR:rbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RBXJA2T_18703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: EGJ12380
UniProt: F3LVL2
LinkDB All DBs
AA seq 144 aa AA seqDB search
MMTNPTGRLTQGQFSFLPDLTDEEITLQIEYGLKKGYAWSVEYSDDPHPRNTYWEMYGMP
MFDLQDAAGVLMELNNCRKTFPSHYIRLMAFDSTRGVESIAMSFIVNRPSTEPGFGVVRQ
EINGRSMRYTVHSYATDKPEAQRY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaaccccaccggccggctcacgcaaggccagttcagcttcctcccggatctg
accgacgaggagatcacgctgcagatcgagtacggcctgaagaagggctacgcctggagc
gtcgagtacagcgacgacccgcatccgcgcaacacgtactgggagatgtacggcatgccg
atgttcgacctgcaggatgccgccggcgtgctgatggagctgaacaactgccgcaagacc
ttccccagccactacatccgcctgatggccttcgactccacccgtggcgtcgagtcgatc
gcgatgagcttcatcgtgaaccggccgtcgacggagcccggcttcggcgtcgtgcgccag
gagatcaacggccgctcgatgcgctacaccgtgcacagctacgcgaccgacaagcccgaa
gcgcaacgatattga

DBGET integrated database retrieval system