KEGG   Ruminococcaceae bacterium CPB6: B6259_02405Help
Entry
B6259_02405       CDS       T04880                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
rbp  Ruminococcaceae bacterium CPB6
Brite
Translation factors [BR:rbp03012]
 Eukaryotic Type
  Elongation factors
   B6259_02405
 Prokaryotic Type
   B6259_02405
Mitochondrial biogenesis [BR:rbp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B6259_02405
Exosome [BR:rbp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B6259_02405
  Exosomal proteins of breast cancer cells
   B6259_02405
  Exosomal proteins of colorectal cancer cells
   B6259_02405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
501034..502236
Genome map
AA seq 400 aa AA seqDB search
MAKEKFDRSKAHVNIGTIGHVDHGKTTLTAAITKVLALKGEASFKDYASIDAAPEERERG
ITINTAHVEYTTDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVYMNKCDQVDDPELLDLVEMEIRDLLNEYGFPGDTTPIVRGSALKALE
CDSKDINAPEYKSIVDLMNIVDDYIPTPDRKSDQPFLMPVEDVFTITGRGTVATGRVERG
MAKIGDEVEIIGLTDERKKSVITGLEMFRKTLDYAEAGDNIGALLRGIQREDIERGQVIA
KPGTIHPHTKFRGQVYVLTKDEGGRHTPFFNNYRPQFYFRTTDVTGVISLPEGTEMCMPG
DNVEMSVELIAPIAIEKGLRFSIREGGHTVGSGVVSDICD
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaaaaattcgacagatctaaggcacacgtgaacattggtaccatcggccat
gttgaccatggtaaaacaaccctgactgctgcgattaccaaggtgcttgcactgaaaggt
gaagcaagcttcaaggattatgccagcatcgatgccgctcctgaagagcgtgagcgcggc
attaccattaacacggctcatgttgagtacaccacagataagcgtcactacgctcatgtt
gactgccccggccatgctgactatgtcaagaacatgattaccggtgctgcacagatggat
ggtgctattctggttgtttccgctgctgatggcccgatgccgcagacccgtgagcatatc
ctgcttgcccgtcaggttggtgtgccttatatcgttgtctatatgaacaaatgcgaccag
gttgatgaccctgagttgctggaccttgttgaaatggaaattcgtgacctgctcaacgag
tacggcttcccgggagacactactccaatcgtacgcggttctgcactgaaagctctggag
tgcgattccaaagatatcaatgcaccggagtacaagagcattgttgacctgatgaacatt
gtcgatgactacatcccgactcctgaccgtaagtctgatcagccgttcctgatgcctgtt
gaagacgtattcaccatcaccggccgtggtactgttgctactggccgtgttgagcgtggt
atggctaaaatcggcgatgaagttgaaatcatcggtctgactgatgagcgtaagaagagc
gttatcaccggtctggaaatgttccgcaaaactctggattacgcagaggctggcgataac
atcggtgctctgctgcgtggtattcagcgtgaagacatcgaacgtggacaggttattgca
aagcctggcactattcatccgcataccaagttcagaggtcaggtttatgttctgactaag
gatgaaggcggccgccatactcctttcttcaacaactaccgtccgcagttctatttccgt
acaactgatgtcaccggcgttatctctctgccggaaggcactgagatgtgcatgcctggc
gataacgttgaaatgtccgttgaactgattgccccaatcgctattgaaaagggcctccgc
ttctccattcgtgaaggcggtcataccgttggttccggcgttgtttccgacatctgtgac
taa

DBGET integrated database retrieval system