KEGG   Rickettsiales bacterium Ac37b: NOVO_03095Help
Entry
NOVO_03095        CDS       T03234                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rbt  Rickettsiales bacterium Ac37b
Brite
Enzymes [BR:rbt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NOVO_03095 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
628244..628894
Genome map
AA seq 216 aa AA seqDB search
MTTLKYSNKYANQTTYPFVLPNLPYNNNALEPYITFNTLNFHHGKHHNTYVTNLNNLIKD
SELSSKSLEEIILSTAKDTSKSGIFNNAAQVWNHTFYWHSMKASGGGMPSPTLLDKINED
FGSFDKFKEEFKNAGTTQFGSGWSWLVLEGNQLKITKTGNADLPLIHNQVALLTCDVWEH
AYYLDYQNRRPDYITTFLEKLVNWEFVEENFLNSQK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgactacattgaaatatagcaataaatatgcaaatcaaacaacatatccctttgtttta
ccaaatttaccttataataacaatgcccttgaaccttatataacttttaatactttaaat
ttccatcatggtaagcatcataatacgtatgttaccaatcttaataatcttattaaagac
tctgaactaagtagtaaatcattagaagaaatcatattatctacagctaaagatacaagt
aaatctggaatttttaataacgctgcccaagtctggaaccatactttctactggcattct
atgaaagctagtgggggaggcatgccttcaccaactttgcttgataaaattaacgaagac
tttggtagctttgataaattcaaagaagaatttaaaaacgctggaactactcaatttggc
agtggttggtcatggctagtattagaaggtaatcaattaaaaattactaaaaccggtaac
gcagaccttcctttaatccataaccaagtagctttgcttacatgcgatgtatgggaacat
gcatattacctagattatcaaaatcgtagaccggattacattactactttcttagagaaa
ttagtcaactgggaatttgttgaagaaaattttttaaattctcaaaaataa

DBGET integrated database retrieval system