KEGG   Rhodobacter capsulatus: RCAP_rcc02667Help
Entry
RCAP_rcc02667     CDS       T01213                                 

Gene name
fabI2
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase-2 (NADH)
  KO
K00208  
enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rcp  Rhodobacter capsulatus
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    RCAP_rcc02667 (fabI2)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RCAP_rcc02667 (fabI2)
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    RCAP_rcc02667 (fabI2)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RCAP_rcc02667 (fabI2)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RCAP_rcc02667 (fabI2)
Lipid biosynthesis proteins [BR:rcp01004]
 Fatty acid synthase
  Component type
   RCAP_rcc02667 (fabI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2860693..2861481)
Genome map
AA seq 262 aa AA seqDB search
MADLMKGKRGLVMGVANERSIAWGIASALAAEGAELAFSYQGEAFGKRVEPLAASVGSSF
LVDVDVNDDASLDAAFQRLKDEWGTIDFVIHAIAYSDKNELAGRFIHTTRDNFKNSLAIS
CYSFIDIARRASELMPNGGSLITLTYGGSNRVTPFYNVMGVAKAALESAVRYLANDLGPQ
GIRVNAISPGPMKTLAGAAIGGARKTFRHTEANSPMRANATLEAVGGSAVFLCSDYGACT
TGDVVMVDCGYHVLGMPQPENI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctgatgaagggaaaacgcggcctcgtcatgggcgtggccaacgagcgctcg
atcgcctggggcatcgcctcggcgcttgcggccgagggggcagagctggccttttcctat
cagggcgaggccttcggcaagcgcgtcgagccgctggcggcttcggtgggctcaagcttc
ctggtcgatgtcgacgtgaacgacgatgcctcgctcgatgccgcgttccagcggctcaag
gacgaatggggcacgatcgacttcgtcatccatgccatcgcctattccgacaagaacgag
ctggcggggcggttcatccacaccacgcgcgacaacttcaagaacagcctggcgatttcc
tgctacagcttcatcgacatcgcccggcgcgcgtcggaactgatgccgaatggcggcagc
ctgatcacgctgacctatggcggctcgaaccgggtgacgccgttttacaacgtcatgggc
gtggccaaggcggcgctggaatcggccgtgcgctatctggcgaatgaccttggcccgcaa
ggcatccgcgtcaatgcgatcagccccgggccgatgaagacgctggcgggtgcggccatc
ggcggcgcgcggaaaaccttccgccacaccgaagccaacagcccgatgcgggccaatgcg
acgctggaggcggtgggcggctcggcggtgttcctctgttccgattacggcgcctgcacg
acgggggatgtggtgatggtcgattgcggctatcatgtgctgggaatgccgcaacccgag
aacatctga

DBGET integrated database retrieval system