KEGG   Rhodobacter capsulatus: RCAP_rcc03146Help
Entry
RCAP_rcc03146     CDS       T01213                                 

Gene name
gabT1
Definition
(GenBank) 4-aminobutyrate aminotransferase-1
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00250  Alanine, aspartate and glutamate metabolism
rcp00410  beta-Alanine metabolism
rcp00640  Propanoate metabolism
rcp00650  Butanoate metabolism
rcp01100  Metabolic pathways
rcp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RCAP_rcc03146 (gabT1)
   00650 Butanoate metabolism
    RCAP_rcc03146 (gabT1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RCAP_rcc03146 (gabT1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RCAP_rcc03146 (gabT1)
Enzymes [BR:rcp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RCAP_rcc03146 (gabT1)
Amino acid related enzymes [BR:rcp01007]
 Aminotransferase (transaminase)
  Class III
   RCAP_rcc03146 (gabT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADE86870
UniProt: D5AR65
LinkDB All DBs
Position
complement(3343031..3344314)
Genome map
AA seq 427 aa AA seqDB search
MTVQTSPDLSARRAAAIAKGVGVTTQIYAERAENAEIWDKNGTRYIDFAAGIAVVNTGHR
HPRVIEAVKAQLDAFTHTCHQVVPYENYVILAERLNAAVPGDFAKKTIFATTGAEAVENA
IKIARHYTGRAGIVAFAGGFHGRTFMGMTLTGKVQPYKAGFGPMMNDVWHLPFPCPLHGV
TGEDAVAALERLFKADIEPARVAAIIVEPVQGEGGFYPVPEGFMRKLREIADKNGIVLIA
DEVQTGFARTGKLFAMEHHGVAADITTMAKGLGGGFPISAVTGRADIMDSPNPGGLGGTY
AGAPIAVAAAHAVLDVIEDEQLCARAERLGARLKQRLAALQDSVPEIIDIRGPGFMNAVE
FNVAGSDTPNPEMTNRVREEALKRGLILLTCGVYGNVIRFLAPLTIQDAVFDEALDILEA
SILAAKG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcaaacctcgcccgacctgtccgcccgccgtgccgccgccatcgccaagggc
gttggcgtgacgacgcagatctatgccgaacgcgccgagaacgcggaaatctgggacaag
aacggcacccgttacatcgacttcgccgcgggcatcgccgtggtgaacaccggccaccgt
cacccgcgggtgatcgaggcggtcaaggcgcagctcgatgccttcacccacacctgccat
caggtcgtgccttacgaaaactacgtcatcctggccgagcgtctgaacgccgccgtgccc
ggtgactttgcgaagaagacgatcttcgccaccaccggcgccgaagccgttgaaaacgcg
atcaagattgcccgccactacaccggccgcgccgggatcgtcgcctttgcgggcggtttc
cacggccgcaccttcatgggcatgacgctgaccggcaaggtgcagccctacaaggccggc
ttcggcccgatgatgaacgacgtctggcacctgcccttcccctgcccgctgcatggcgtg
acgggcgaggacgccgtggcggcgctggagcgtctgttcaaggccgatatcgaacccgcc
cgcgtcgccgcgatcatcgtcgagccggtgcagggcgagggcggcttctacccggtgccc
gagggcttcatgcgcaaactgcgcgagatcgccgacaagaacggcatcgtcctgatcgcc
gacgaggtgcagaccggctttgcccgcaccggcaagctctttgcgatggaacatcacggg
gttgccgccgatatcaccaccatggccaaggggctgggcggcggcttcccgatctcggcg
gtgaccggccgcgccgacatcatggacagcccgaacccgggcggccttggcggcacctat
gccggggcgccgattgccgtggccgcggcgcatgccgttcttgacgtgatcgaggacgag
cagctctgcgcccgtgccgagcgtctgggcgcgcggctgaaacagcgtctggcggcgctg
caggacagcgtgccggagatcatcgacatccgcggcccgggcttcatgaacgcggtcgag
ttcaacgtcgcgggcagtgacacgccgaacccggagatgaccaaccgcgtccgcgaagag
gcgctgaagcgcggtctgatcctgctcacctgcggcgtttacggcaacgtcatccgtttc
ctcgccccgctgaccatccaggacgcggtctttgacgaggcgctggacatcctcgaagcc
tcgatcctcgccgcgaagggctga

DBGET integrated database retrieval system