KEGG   Ricinus communis (castor bean): 8265150Help
Entry
8265150           CDS       T01087                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00010  Glycolysis / Gluconeogenesis
rcu00051  Fructose and mannose metabolism
rcu00052  Galactose metabolism
rcu00500  Starch and sucrose metabolism
rcu00520  Amino sugar and nucleotide sugar metabolism
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
rcu01200  Carbon metabolism
Module
rcu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rcu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8265150
   00051 Fructose and mannose metabolism
    8265150
   00052 Galactose metabolism
    8265150
   00500 Starch and sucrose metabolism
    8265150
   00520 Amino sugar and nucleotide sugar metabolism
    8265150
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    8265150
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     8265150
Membrane trafficking [BR:rcu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    8265150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 8265150
NCBI-ProteinID: XP_002514221
UniProt: B9RKH7
LinkDB All DBs
Position
Un
AA seq 498 aa AA seqDB search
MGKVAVGAAAVCAAAVCASAALVVRHRMKSSGRWTRAMAILGEFEEKCGTPVGKLRQVAD
AMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGLFYALDLGGTNFRVLRVLLGGKEDR
VVKQEFEEVSIPPHLMIGSSDALFDFIADALKKFVATEGEDLHPLPGQQRELGFTFSFPV
RQASIASGTLIKWTKGFSIEDTVGEDVVGELTKAMDRVGLDMRVAALVNDTIGTLAGGRY
HSQDVIAGVILGTGTNAAYVERAQAIPKWHGLLPKSDEMVINMEWGNFRSSHLPLTEYDE
ALDIESLNPGEQIFEKIISGMYLGEIVRRVLLKMAEEANLFGDVVPPKLEIPFILRTPVM
SAMHQDTSSDLRVVGSKLKDILEIPNTSLKTRKAIVKLCDIVATRGARLSAAGIVGILKK
LGRDTIKEREKHKSVIAMDGGLFEHYTKFRVCLESTIEELLGKEVSENIVVEHSNDGSGI
GAALLAASHSLYREVAEY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggggcggcggccgtgtgtgcagcggcggtgtgtgcgtcggcg
gcactagtggtgaggcataggatgaagagctcaggaaggtggaccagagccatggcgata
cttggagagtttgaagagaagtgtggcacccctgtcggaaaattaagacaggtggcagat
gctatgaccgtcgagatgcatgctggtcttgcatcggagggtggtagtaaacttaagatg
atcattagctacgttgataatcttcctaccggggatgagaaggggctgttttatgcatta
gaccttggtggcacaaattttcgcgtcttacgtgtacttttgggagggaaagaagatcgt
gttgtcaaacaagaatttgaggaagtttctattcctccacacttgatgattggatcttca
gatgcattattcgattttattgcggacgcacttaaaaagtttgttgctacagaaggtgaa
gacttgcaccctttgcctggtcaacaaagggaactgggctttaccttctcattcccagtt
aggcaagcgtcaatagcatcaggaactcttataaaatggacaaaaggtttctctatagaa
gatacagttggggaagatgtggtaggagaattgacaaaagccatggacagagttggtctt
gacatgcgtgttgcagctttggtcaatgatacaattggaacattagctggaggtagatac
cacagccaggatgttattgctggagtaatcttgggcactggaacaaatgcagcctatgta
gaacgggcacaagcaattcccaagtggcatggtcttctacctaaatcagatgaaatggta
atcaatatggagtggggtaacttccgatcatcacaccttccacttacagaatatgatgag
gctctggatattgagtctctgaacccaggggaacagattttcgagaagatcatttctggt
atgtatttgggagagattgtacggagagttctgttgaagatggccgaggaagctaacctt
tttggtgatgttgttccaccaaaactggagattccattcattctaaggactcctgtcatg
tcagctatgcatcaagatacatcttcagatctgagagtcgttggaagcaaactaaaggat
atcttagagatacctaatacctctctgaaaacgaggaaagctatagttaagctttgtgac
attgttgccactcgtggtgcccgcctctctgcagccggaatagtaggcatactcaagaaa
ttgggaagagacacaataaaggaaagggaaaagcataagtcagtaatagcaatggatgga
gggctttttgagcactacactaagtttcgtgtatgcttggagagcacgattgaggagttg
ctgggaaaggaagtttctgagaacattgttgttgagcactcaaatgatggctcaggcatc
ggagcagctctgctggcagcttcccactccctataccgggaggttgctgaatactga

DBGET integrated database retrieval system