KEGG   Ricinus communis (castor bean): 8266510Help
Entry
8266510           CDS       T01087                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    8266510
Enzymes [BR:rcu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     8266510
Transporters [BR:rcu02000]
 Other Transporters
  Pores ion channels [TC:1]
   8266510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 220 aa AA seqDB search
MSEGEVVVLDFWVSPFCMRVKIALNEKGVSYEAREEDLFGGKSELLIKSNPVYQKVPVFL
HDGKPLSESVVIVGYIDETWPSPALLPPCPYGRAQARFWADYIDKRLFDALGGIWRSKGE
DTEVAKKDFIEILKVLEGALGEKDFFGGESFGFVDIIAIPLTCWFLAVEKLADFSVESEC
PKFAAWIKRCMQRESVAKIIPDPEKVYEFVLMMRKMHGIN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagggagaggtggttgttcttgacttttgggttagccctttctgcatgagggtt
aagattgcactgaatgagaagggagtgagctacgaggcaagagaggaagatttatttggt
gggaaaagtgaattgttgataaaatcaaacccagtttaccaaaaggtacctgtgtttttg
catgacgggaagccattgagcgagtccgttgtgattgttgggtacatcgatgagacatgg
ccttcaccagcattgctcccaccttgtccttatggtcgtgctcaagcccgcttctgggct
gattacatcgacaaaaggctattcgatgcacttggtggaatttggaggagcaaaggagag
gatacagaggtagcaaagaaagacttcatagagatattgaaggtgttagaaggagccctt
ggagagaaagatttctttggaggggaaagttttggttttgttgatataattgcaatccct
ttaacctgttggttcttggctgttgagaaattggcagacttcagtgtggaatctgagtgc
cctaaatttgctgcttggataaagaggtgcatgcaaagagagagtgttgccaaaatcatt
cctgatccagaaaaagtctatgaatttgtgctcatgatgaggaagatgcatgggattaat
tag

DBGET integrated database retrieval system