KEGG   Ricinus communis (castor bean): 8284786Help
Entry
8284786           CDS       T01087                                 

Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00240  Pyrimidine metabolism
rcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    8284786
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     8284786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 RecA
Motif
Other DBs
NCBI-GeneID: 8284786
NCBI-ProteinID: XP_002533863
UniProt: B9T6J4
LinkDB All DBs
Position
Un
AA seq 234 aa AA seqDB search
MATLRSSISMTSSIDGDGHNKPAGEVHVIVGPMFAGKTTALLRRINSEGSNGRNVAMIKS
SKDTRYARDSVVTHDGLKFPCWALPDLSSFRDKLGHDAYQRIDVIGIDEAQFFEDLYDFC
SKAADHDGKTVIVAGLDGDYLRRSFGSVLDVIPLADNVTKLTARCELCGKRAFFTLRKTA
ETQTELIGGADMYMPVCRRHYVNGQVVMEAARNVLVADSCKLQPDSHAEIANVV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccactctcagatcctcaatttccatgacctcctcaatcgatggagatggtcataat
aagccagccggtgaggttcatgtcattgtgggtcccatgtttgctggaaaaaccactgct
cttctccgtcgtatcaattccgaaggcagcaacggcagaaatgtagcaatgataaaatca
agcaaggatactagatatgctagagattcagtggttacacatgatggattgaaatttcct
tgttgggctttgccagatctatcctctttccgagacaaacttggtcatgatgcttatcaa
aggattgatgttattggtattgatgaggctcaattctttgaagacctttatgatttttgc
agcaaggctgctgatcatgatggaaaaactgtaattgtagcaggtcttgatggagattat
ctaaggaggagctttggttctgtgcttgatgtgattccgcttgctgataatgtaaccaag
ttgactgcgcgatgtgagctttgtggcaagcgcgctttctttaccttaaggaagacagca
gagacacagacagaactaattggcggtgctgatatgtatatgcctgtttgccgccgacac
tacgtcaatggacaagttgtcatggaagctgctcggaatgtcctggtggcggattcatgc
aaacttcagcctgactcgcatgctgagatagcgaatgttgtctag

DBGET integrated database retrieval system