KEGG   Rhizorhabdus dicambivorans: CMV14_15620Help
Entry
CMV14_15620       CDS       T05084                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rdi  Rhizorhabdus dicambivorans
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rdi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CMV14_15620
Enzymes [BR:rdi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CMV14_15620
Transporters [BR:rdi02000]
 Other Transporters
  Pores ion channels [TC:1]
   CMV14_15620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3307935..3308606)
Genome map
AA seq 223 aa AA seqDB search
MWQLYQFPLCPFSRKVRLQMEEKGIAYDLVRESPWLRRDEFLDLNPVGQTPVMVDPATGT
TLIHSCAISEYIEETVEPVPMIPGNAAARAEIRRLVAYFDEKFYSDVVGPLLYERALKRI
VHRAPPDAGVLRQAMKAVNDHLDYIDYLVGSRRWIGGQLISLADLACAAHISVADYLGGI
DWRGHDETRQWYSGMKSRRSLRVILSERMELVGPPEHYEKPDF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctttaccaattcccgctctgtcccttttcccgcaaggtccggctccagatg
gaggagaagggcatcgcctatgatctcgtccgcgaatcgccgtggctgcggcgggacgag
ttcctcgatctgaatccggtcgggcagactccggtgatggtcgatccggcgacggggacc
acgctgatccacagctgcgccatctccgaatatatcgaggagacggtcgagccggtgccg
atgatcccgggcaacgccgccgcgcgcgccgagatacgccggctggtcgcctatttcgac
gagaaattctattctgacgtggtcggtccgctgctctatgagcgcgcgctcaagcgcatc
gtccaccgcgccccgcccgatgccggcgtgctccgtcaggcgatgaaggcggtcaacgac
catctcgactatatcgactatctggtcggcagtcgtcgctggatcggcggccagctgatc
agcctcgccgacctcgcctgcgccgcgcatatctcggtcgccgactatctcggcgggatc
gactggcgcggccatgacgagacccggcaatggtattcgggcatgaagtcccgccgctcg
ctgcgggtgatcctgtccgagcggatggagctggtcggcccgcccgaacattatgagaag
cccgatttctaa

DBGET integrated database retrieval system