KEGG   Roseateles depolymerans: RD2015_302Help
Entry
RD2015_302        CDS       T04166                                 

Definition
(GenBank) Glutathione S-transferase-like protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rdp  Roseateles depolymerans
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rdp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RD2015_302
Enzymes [BR:rdp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RD2015_302
Transporters [BR:rdp02000]
 Other Transporters
  Pores ion channels [TC:1]
   RD2015_302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(336006..336653)
Genome map
AA seq 215 aa AA seqDB search
MIELHYFPSNASMAPHILLQELGVDFQLRLVDRNRNEHKSPDFLKLNPNGLLPVLCDDDL
VLHETAAILLHLADTHPEAGLVPAVGTRERALTYKWLMWLTNTLQPSLIAYYYPERWVAE
GNTAGSAEVKAQAEARIGGQLDLLVAEFERHGGPWLLGDRYSLLDPLAFMLCRWTRGFAH
PARARPVLGAYLDRVAERPAVIRALETEALPKPWY
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaactgcactactttcccagcaatgccagcatggcgccccacatcctgctgcag
gaactgggcgtggatttccagctgcgactggtggaccgcaaccgcaacgaacacaagtcg
ccggacttcctgaagctcaatccgaacggcctgctgccggtgctgtgcgacgacgacctg
gtgctgcacgaaaccgccgccatcctgctgcatctggcggacacgcatccggaggcgggt
ctggtgccggcggtgggcacgcgggagcgcgcgctcacctacaagtggctgatgtggctg
accaacaccctgcagccgtccctgatcgcctattactaccccgagcgctgggtggcggaa
ggcaatacggccggcagcgccgaggtgaaggcgcaggccgaagcccgcattggcggccaa
ctggatctgctggtcgcggaatttgaacgccacggcggcccctggctgctgggagatcgc
tactccctgctggacccgctggccttcatgctgtgccggtggacccggggctttgcgcat
ccggcgcgcgcccgtccggttctgggcgcctatctggaccgagtggccgagcggccggcg
gtgatccgggcactggagaccgaggcgctgcccaagccgtggtactga

DBGET integrated database retrieval system