KEGG   Roseateles depolymerans: RD2015_3307Help
Entry
RD2015_3307       CDS       T04166                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rdp  Roseateles depolymerans
Brite
Enzymes [BR:rdp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RD2015_3307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALV07765
UniProt: A0A0U3E3I9
LinkDB All DBs
Position
complement(3867422..3868003)
Genome map
AA seq 193 aa AA seqDB search
MEHVLPDLPYDKNALAPHISAETLEYHHGKHHKAYVDNLNNLQKGTEFESKTLEEIVKTS
SGGIYNNAAQIWNHTFFWNCLRPNGGGAPTGALADAINAKWGSYDAFKEAFQKSAVGNFG
SGWTWLVKKADGSVDIVNMGAAGTPLTTGDTPLLTIDVWEHAYYIDYRNARPKFVETFLK
SLVNWEFAQANFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacacgttctgcccgatctgccttacgacaagaatgccctggccccgcacatcagc
gccgagacgctggagtaccaccacggcaagcatcacaaggcctacgtggacaacctgaac
aacctgcaaaagggcacggagttcgagtccaagacgctggaagagatcgtcaagacctcc
agcggcggcatctacaacaacgccgcccagatctggaaccacaccttcttctggaactgc
ctgcgcccgaacggcggcggcgccccgaccggtgcactggcggacgccatcaatgccaag
tggggcagctacgacgccttcaaggaagccttccagaagagcgccgtgggcaacttcggt
tcgggctggacctggctggtgaagaaggccgacggttcggtggacatcgtcaacatgggc
gccgccggcaccccgctgacgaccggtgacacgccgctgctgaccatcgacgtgtgggaa
cacgcctactacatcgactaccgcaatgcgcgtccgaagttcgtcgagaccttcctgaag
agcctggtgaactgggaattcgcgcaggccaacttcgcctga

DBGET integrated database retrieval system