KEGG   Roseibacterium elongatum: roselon_00856Help
Entry
roselon_00856     CDS       T03060                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
red  Roseibacterium elongatum
Pathway
red00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:red00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    roselon_00856
Enzymes [BR:red01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     roselon_00856
Transporters [BR:red02000]
 Other Transporters
  Pores ion channels [TC:1]
   roselon_00856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_N_4 Tom37 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AHM03266
UniProt: W8S3C3
LinkDB All DBs
Position
831586..832185
Genome map
AA seq 199 aa AA seqDB search
MSDDYKVIGSVKSRALRVLWLLEEMGLPYEHVPAAPRSDEVTRFSPAGKIPVLIAEGVPI
TDSVAIMTYLADKHGQFTHPAGTIERARQDSLTHAINDEFDAVLWTAARHSFILPEDKRT
PEVKDSLKWEFERSQEGFTHRMAEDGPFLMGETMTLPDILLAHCMGWAVSAKFPVSDPRI
RAHAAMMRDRPAFKRALEA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgactacaaggtgatcggcagcgtcaagagccgcgcgttgcgcgtgctctgg
ctgctcgaggaaatgggcctgccttacgagcatgtccccgccgccccccgctcggacgag
gtcacgcgcttcagccccgcaggcaagatccccgtcctgatcgccgaaggcgtcccgatc
accgattcggtggcgatcatgacctatctcgccgacaagcacgggcagttcacccacccc
gccggcaccatcgaacgcgcaaggcaggatagtctgacccacgccatcaatgacgagttc
gatgccgtcctctggaccgccgcgcgccacagcttcatcctgcccgaggacaagcgcacc
cctgaggtgaaggactcgctcaaatgggaattcgaacgctcgcaagagggattcacccat
cgcatggccgaggatgggcccttcctgatgggtgaaacgatgactctccccgacattctg
cttgcccattgcatgggctgggccgtcagcgcgaaattcccggtctccgatccgcgcatc
cgggcgcacgccgcgatgatgcgcgaccgccccgccttcaaacgcgcgctcgaagcctag

DBGET integrated database retrieval system