KEGG   Ralstonia eutropha H16: H16_A2508Help
Entry
H16_A2508         CDS       T00416                                 

Gene name
h16_A2508
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00564  Glycerophospholipid metabolism
reh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    H16_A2508 (h16_A2508)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     H16_A2508 (h16_A2508)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like Pyr_redox_2 GIDA NAD_binding_8 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: CAJ93596
UniProt: Q0K8S5
LinkDB All DBs
Position
1:2723555..2725159
Genome map
AA seq 534 aa AA seqDB search
MQRVSTPIQPPDRAALLATLEREPRWDVIVIGGGATGLGTAVDAASRGYRTLLVEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLARNAPHLVWPLGFVVPAYQLFDQP
FYGIGLKVYDMLAGDLNLAGSRWLNHREVLAAAPNLAEHVGGRPLRGGNLYFDGQFDDAR
LAVALMRTLFDVGGTALNYMRVTGLSQQGGVISGVTVQDVLGDATFHLRADCVINATGVW
VDAIRQMEDGHARAMVAPSQGVHLTLPRSFLPGERAILIPKTDDGRVLFVVPWNGHTIVG
TTDTPRRDLPLEPDAGADDVDFILETASRYLARDPTRADVTSVWAGLRPLVRATGEASTA
SLSREHTILVSKAGLITVTGGKWTTYRKMAEDVIETAIQRQMVRAAPCVTAELPLHGAAG
LPAGLPPPDSGSPDRYYGNELDLLRALPGYDRMLAPASGLTEAHVRFAARHELARRVEDV
LARRNRALFLDARAAVDAAPAVAAILAEELGEDEAWQAREIESFRTLAAGYMLG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcagagagtctccaccccgatccagccccccgaccgcgccgccctgctcgccaccctg
gagcgcgagccgcgctgggatgtgatcgtcatcggcggcggcgccaccggcctgggcacc
gcagtcgacgccgcctcgcgcggctaccgcacgctgctggtcgaagccgcggattttgcc
aagggcacctccagcaaggccaccaagctggtgcatggcggcgtgcgctacctggcccag
ggcaatatcagcctggtgcgcgaggccctgcacgagcgcggcctgctggcgcgcaacgcg
ccgcacctggtgtggccgctgggcttcgtggtgccggcctaccagctgttcgaccagccc
ttctacggcatcggcctcaaggtctacgacatgctggccggcgacctcaacctggccggc
agccgctggctgaaccaccgcgaggtgctggccgcggcgcccaacctggccgagcacgtc
ggcgggcgtccgctgcgcggcggcaacctgtatttcgacggccagttcgacgatgcgcgg
ctggcggtggcgctgatgcgcacgctgttcgacgtgggcggcaccgcgctcaactacatg
cgcgtgacgggcctgagccagcaaggcggcgtgatcagcggcgtgaccgtgcaggatgtg
ctcggcgacgccaccttccacctgcgcgccgactgcgtgatcaacgccaccggcgtgtgg
gtcgatgcgatccggcagatggaagacggccacgcgcgcgccatggtcgcgcccagccag
ggcgtgcacctgacgctgccgcgcagcttcctgccgggcgagcgcgccatcctgatcccc
aagaccgacgacggccgggtgctgttcgtggtgccctggaacggccacaccatcgtcggc
accaccgacaccccgcgccgcgacctgccgctggaaccagacgccggcgccgacgacgtc
gacttcatcctggaaaccgcgtcgcgctacctcgccagggacccgacccgcgccgacgtc
accagtgtctgggccggcctgcggccgctggtgcgggccaccggcgaggcctctaccgcg
tcgctgtcgcgcgagcatacgatcctggtgtccaaggccgggctgatcaccgtcaccggc
ggcaagtggaccacttaccgcaagatggctgaagacgtgatcgagaccgcgatccagcgc
cagatggtgcgcgcggccccgtgcgtgaccgccgagctgcccctgcacggcgcggcgggg
ctgccggccgggctgccgccgccggattcaggctcgccggaccgctactacggcaatgag
ctggacctgctgcgcgcgctgcccggatatgaccgcatgctggcaccggcgtcaggcctg
accgaagcgcacgtgcgctttgcggcccggcacgaactggcgcgccgggtcgaggacgtg
ctggcccgccgcaaccgcgcgctgttcctggacgcgcgcgccgccgtggacgccgcgccg
gccgtggccgctattctggccgaggaactcggcgaggacgaggcctggcaggcgcgcgaa
atcgagagtttccgcacgctcgccgccggctacatgctcggctga

DBGET integrated database retrieval system