KEGG   Ralstonia eutropha H16: H16_A2861Help
Entry
H16_A2861         CDS       T00416                                 

Gene name
h16_A2861
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    H16_A2861 (h16_A2861)
Enzymes [BR:reh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     H16_A2861 (h16_A2861)
Transporters [BR:reh02000]
 Other Transporters
  Pores ion channels [TC:1]
   H16_A2861 (h16_A2861)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_4 GST_C_3
Motif
Other DBs
NCBI-ProteinID: CAJ93938
UniProt: Q0K7T3
LinkDB All DBs
Position
1:complement(3087555..3088208)
Genome map
AA seq 217 aa AA seqDB search
MSKTTLTISSKTYSSWSLRGWLLARFAGLEFEEVLVPPDDAAARAEILLLSPSILVPCLR
HHGVTVWDTLAIAEYLNEIHPKAGLLPEDRAARAHCRAICGEMHSGFAAMRSALPMNLKG
HFPGMKVWSRAQADIDRVTAIWTECLTRYGGPYLFGTRTMADAMYAPVVTRFVTYGVMLD
PVPVAYCKQILSMPELQEWIAAAREEPDEISELDVEF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaccacactcaccattagcagcaagacctattcctcatggtcgctgcgcggc
tggctgctggcgcgctttgccggcctggaattcgaagaagtgctggtgccgccggacgac
gccgcggcgcgtgcggaaatcctgctgctgtccccgtcgatcctggtgccgtgcctgcgc
caccacggcgtgacggtgtgggacacgctggcaatcgccgaatacctgaatgaaatccac
cccaaggctggcctgctgccggaagaccgcgccgcgcgtgcccactgccgtgccatctgc
ggcgagatgcattccgggttcgccgcgatgcgttcggcgctgccgatgaacctgaagggg
catttccccgggatgaaggtgtggtcgcgtgcgcaggcggacatcgatcgcgtcacggcg
atctggaccgaatgcctgacgcgctacggcgggccatacctgttcggcacgcgcaccatg
gccgacgccatgtacgcgccggtggtgacgcgctttgtcacctatggcgtgatgctcgat
cccgtgccggttgcctactgcaagcagatcctgtcgatgccggaactgcaggagtggatc
gcggcggcgcgcgaggaacccgacgaaatcagcgagctggatgtggagttctag

DBGET integrated database retrieval system