KEGG   Ralstonia eutropha H16: H16_A3056Help
Entry
H16_A3056         CDS       T00416                                 

Gene name
icd1
Definition
(GenBank) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00020  Citrate cycle (TCA cycle)
reh00480  Glutathione metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
reh01200  Carbon metabolism
reh01210  2-Oxocarboxylic acid metabolism
reh01230  Biosynthesis of amino acids
Module
reh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H16_A3056 (icd1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    H16_A3056 (icd1)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     H16_A3056 (icd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CAJ94131
UniProt: Q0K790
LinkDB All DBs
Position
1:complement(3309783..3311033)
Genome map
AA seq 416 aa AA seqDB search
MYQHIKVPAGEKITVNQDFSLNVPDNPIIPYIEGDGTGLDITPVMIKVVDAAVAKAYGGK
RKIAWMEIYAGEKSTKVYGPDVWLPDETLEVLKDYVVSIKGPLTTPVGGGIRSLNVALRQ
QLDLYVCLRPVRYFKGVPSPVREPEKTDMVIFRENSEDIYAGIEWAAESEQAKKLIKFLQ
DEMGVKKIRFPATSGIGIKPVSREGTERLVRKAIQYAIDNDKPSVTLVHKGNIMKFTEGG
FRDWGYELAQKEFGAELVDGGPWCKFKNPKTGKDIVIKDAIADAFLQQILLRPAEYSVIA
TLNLNGDYVSDALAAQVGGIGIAPGANMSDSVAMFEATHGTAPKYAGKDYVNPGSEILSA
EMMLRHMGWTEAADLIISSMEQSILSKKVTYDFARLLEGATQVSCSGFGQVMIDNM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaacatatcaaggttccggccggcgaaaagatcacggtcaaccaggacttttcg
ctgaatgtcccggacaatccgatcattccttacatcgaaggcgacggtacgggcctcgat
atcaccccggtgatgatcaaggtggtcgacgcggctgtggccaaggcctatggcggcaag
cgcaagatcgcctggatggagatctacgccggcgagaagtccaccaaggtctacggcccg
gacgtgtggctgccggacgaaaccctggaggtgctcaaggattacgtggtctcgatcaag
ggtccgctgaccacgccggtgggcggcggcatccgctcgctgaacgtggcactgcgccag
cagctggacctgtacgtctgcctgcgcccggtgcgctacttcaagggcgtgccctcgccg
gtgcgtgagccggaaaagaccgacatggtgatcttccgcgagaactcggaagacatctac
gccggcatcgaatgggcggcggaaagcgagcaggcgaagaagctcatcaagttcctgcag
gacgagatgggcgtgaagaagatccgcttcccggcgacctcgggcatcggcatcaaaccg
gtctcgcgcgagggcaccgagcgtctggtgcgcaaggcgatccagtacgccatcgacaac
gacaagccgtcggtgacgctggtgcacaagggcaacatcatgaagttcaccgaaggtggc
ttccgtgactggggctacgagctggcgcaaaaggaattcggcgccgagctggtcgacggc
ggcccgtggtgcaagttcaagaacccgaagaccggcaaggacatcgtgatcaaggacgcc
attgccgacgccttcctgcagcagatcctgctgcgtccggccgaatactcggtgatcgcc
acgctgaacctgaacggcgactatgtctccgacgcgctggccgcacaggtcggcggcatc
ggcatcgccccgggcgccaatatgtctgactcggttgccatgttcgaggccacccacggc
accgcgccgaagtacgccggcaaggactacgtcaacccgggctcggaaatcctgtcggcc
gaaatgatgctgcgtcacatgggctggaccgaagccgcggacctgatcatctcgtcgatg
gagcagtcgatcctgtccaagaaggtgacgtatgacttcgcccgcctgctggaaggcgcg
acgcaggtgtcgtgctcgggctttggccaggtgatgatcgacaatatgtaa

DBGET integrated database retrieval system