KEGG   Ralstonia eutropha H16: H16_B0571Help
Entry
H16_B0571         CDS       T00416                                 

Gene name
h16_B0571
Definition
(GenBank) Glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
reh  Ralstonia eutropha H16
Brite
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     H16_B0571 (h16_B0571)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:643188..643892
Genome map
AA seq 234 aa AA seqDB search
MPDLSAFPITRKWPAQHPDRIQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDANDQMSP
EFLSLSPNNKIPAILDPNGPGGKPLALFESGAILLYLADKSGQLIPADPARRYETIQWVM
FQMGGIGPMFGQVGFFHKFAGKEYEDKRPRDRYVAESRRLLNVLNQRLEGRDWIMGDTYT
IADIATFPWVRNLLGFYEAGELVGIQDFPHVRRVLEAFVKRPAVVKGLDTPHRG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgatctgtccgctttccccatcacccgcaaatggccggcgcagcatcccgaccgc
atccagctgtattccctgcccacgcccaacggggtcaaggtgtcgatcatgctggaggag
accggcctgccgtatgaaccgcacctggtgcgcttcgacgccaacgaccagatgtcgccg
gagttcctgtcgctgagcccgaacaacaagattcccgccatcctcgatcccaacggtccg
ggcggcaagccgctggcgctgttcgaatcgggcgcgatcctgctctacctggccgacaag
tcgggccagctgatcccggccgaccccgcgcgccgctacgaaaccatccagtgggtgatg
ttccagatgggcggcatcgggccgatgttcgggcaggtgggctttttccacaagttcgcg
ggcaaggagtacgaggacaagcgcccgcgcgaccgctacgtggccgaaagccggcgcctg
ctgaatgtgctgaaccagcggctggaagggcgcgactggatcatgggcgacacctacacc
attgccgatatcgccaccttcccgtgggtgcgcaacctgcttggcttctatgaggcgggc
gaactggtcggcatccaggacttcccgcatgtcaggcgcgtgctggaggccttcgtgaag
cgcccggcggtggtgaaggggctcgatacgccgcaccgcggctga

DBGET integrated database retrieval system