KEGG   Ralstonia eutropha H16: H16_B0961Help
Entry
H16_B0961         CDS       T00416                                 

Gene name
pyk3
Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
reh  Ralstonia eutropha H16
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H16_B0961 (pyk3)
   01230 Biosynthesis of amino acids
    H16_B0961 (pyk3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_B0961 (pyk3)
   00620 Pyruvate metabolism
    H16_B0961 (pyk3)
  Nucleotide metabolism
   00230 Purine metabolism
    H16_B0961 (pyk3)
Enzymes [BR:reh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     H16_B0961 (pyk3)
Exosome [BR:reh04147]
 Exosomal proteins
  Proteins found in most exosomes
   H16_B0961 (pyk3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
2:1082768..1084186
Genome map
AA seq 472 aa AA seqDB search
MRRLRNAKIVATLGPASSTPELIDALFEAGADVFRLNFSHGTHEDHRQRFEAIRAVERKR
GRPIGVLLDLQGPKLRIGTFADGPVQLAAGAGFRLDLDSAAPGSASRVCLPHPEIFAALS
EGVELLLDDGKIRLRVEQCGAGFAETTVVNGGTLSDRKGVNVPDAVLPLSAMTEKDRRDL
DFGLALGADWIALSFVQRPEDIREIKAIVNGRAGIVAKLEKPAAIQSLDLIVAEADAIMV
ARGDLGVEMPAEQVPSLQKQIVRACRKAGKPVIVATQMLESMIAAPVPTRAEASDVATAI
YDGADAVMLSAESASGRYPVEAVRMMNSIISRTESDPLYRDAIEASHTPPRADAADAIGY
AVRHIVGLLRVPATVAYTSSGYSALRMARERPQVPILGMTPRMATARRLTLTWGVHAVLC
HEVLDVPEMTDLASRTVLAEGFGEAGQSVVISAGLPFLVAGTTNLLRIAQIQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagacgccttcgcaacgccaagatcgtggccacgctgggccccgcgagtagcaccccc
gagctcatcgacgcgctgttcgaggccggtgccgatgtcttccggctcaacttcagccac
ggcacccacgaagaccaccggcaacggttcgaagcgatccgcgccgtggagcgcaagcga
ggccgccccatcggtgtgctgctcgacctgcagggtccgaagctgcgcatcggcaccttc
gccgacgggccagtgcaactggccgcgggagccggcttccggctggacctggacagcgcg
gcgcccggctcggccagcagggtctgcctgccgcacccggagatcttcgccgcgctgagc
gaaggcgtcgagctgctgctggacgacggcaagatccggttgcgcgtcgagcagtgcggc
gccggcttcgccgagaccacggtcgtcaacggcggtacgctctcggaccgaaaaggggtg
aacgtgcctgatgcggtgctgccgctgtcggccatgaccgaaaaagaccggcgcgacctc
gacttcggtctggccctgggggcggactggatcgcgctgtccttcgtgcagcggcccgaa
gacatccgggagatcaaggcaattgtcaacggccgcgccggcatcgtggccaagctggag
aagcccgccgccatccagagcctggatctgatcgtcgccgaggccgatgccatcatggtg
gcgcgcggcgacctgggcgtggagatgccggccgagcaggtgccctcgctgcagaagcag
atcgtccgcgcatgccgcaaggccggcaagccggtcatcgttgccacgcaaatgctcgaa
tcgatgattgccgccccggtgcccacccgcgcggaagcgtcagacgtggcgacggcgatc
tacgacggtgccgacgcggtcatgctgtcggccgagtcggcttcgggccggtatccggtg
gaggcggtgcgaatgatgaacagcattatctcccgcacggaatccgacccgctgtaccgc
gacgccatcgaggcatcccacacgccgccgcgcgcggacgcggctgatgccatcggttat
gcggtgcggcatatcgtgggcttgctcagggtgccggcgacggtcgcctataccagctcg
ggctattcggcgctgcgtatggcgcgcgagcggccgcaggtgcccattctcggcatgaca
ccgcgcatggcgacggcgaggcggctgacgctcacctggggcgtgcatgcggtgctctgc
cacgaggtgctggatgtgccggagatgaccgatctggccagccgcactgtgctggcggag
ggcttcggggaagccggacagtccgtcgtcatctccgcggggctgccgttcctggtggcg
ggaaccaccaacctgctgcggattgcgcagatccaatga

DBGET integrated database retrieval system