KEGG   Ralstonia eutropha H16: H16_B0961Help
Entry
H16_B0961         CDS       T00416                                 

Gene name
pyk3
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00010  Glycolysis / Gluconeogenesis
reh00230  Purine metabolism
reh00620  Pyruvate metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
reh01200  Carbon metabolism
reh01230  Biosynthesis of amino acids
Module
reh_M00002  Glycolysis, core module involving three-carbon compounds
reh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
reh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_B0961 (pyk3)
   00620 Pyruvate metabolism
    H16_B0961 (pyk3)
  Nucleotide metabolism
   00230 Purine metabolism
    H16_B0961 (pyk3)
Enzymes [BR:reh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     H16_B0961 (pyk3)
Membrane trafficking [BR:reh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    H16_B0961 (pyk3)
Exosome [BR:reh04147]
 Exosomal proteins
  Proteins found in most exosomes
   H16_B0961 (pyk3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C Glyco_hydro_3_C IMPDH
Motif
Other DBs
NCBI-ProteinID: CAJ95752
UniProt: Q0K2M2
LinkDB All DBs
Position
2:1082768..1084186
Genome map
AA seq 472 aa AA seqDB search
MRRLRNAKIVATLGPASSTPELIDALFEAGADVFRLNFSHGTHEDHRQRFEAIRAVERKR
GRPIGVLLDLQGPKLRIGTFADGPVQLAAGAGFRLDLDSAAPGSASRVCLPHPEIFAALS
EGVELLLDDGKIRLRVEQCGAGFAETTVVNGGTLSDRKGVNVPDAVLPLSAMTEKDRRDL
DFGLALGADWIALSFVQRPEDIREIKAIVNGRAGIVAKLEKPAAIQSLDLIVAEADAIMV
ARGDLGVEMPAEQVPSLQKQIVRACRKAGKPVIVATQMLESMIAAPVPTRAEASDVATAI
YDGADAVMLSAESASGRYPVEAVRMMNSIISRTESDPLYRDAIEASHTPPRADAADAIGY
AVRHIVGLLRVPATVAYTSSGYSALRMARERPQVPILGMTPRMATARRLTLTWGVHAVLC
HEVLDVPEMTDLASRTVLAEGFGEAGQSVVISAGLPFLVAGTTNLLRIAQIQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagacgccttcgcaacgccaagatcgtggccacgctgggccccgcgagtagcaccccc
gagctcatcgacgcgctgttcgaggccggtgccgatgtcttccggctcaacttcagccac
ggcacccacgaagaccaccggcaacggttcgaagcgatccgcgccgtggagcgcaagcga
ggccgccccatcggtgtgctgctcgacctgcagggtccgaagctgcgcatcggcaccttc
gccgacgggccagtgcaactggccgcgggagccggcttccggctggacctggacagcgcg
gcgcccggctcggccagcagggtctgcctgccgcacccggagatcttcgccgcgctgagc
gaaggcgtcgagctgctgctggacgacggcaagatccggttgcgcgtcgagcagtgcggc
gccggcttcgccgagaccacggtcgtcaacggcggtacgctctcggaccgaaaaggggtg
aacgtgcctgatgcggtgctgccgctgtcggccatgaccgaaaaagaccggcgcgacctc
gacttcggtctggccctgggggcggactggatcgcgctgtccttcgtgcagcggcccgaa
gacatccgggagatcaaggcaattgtcaacggccgcgccggcatcgtggccaagctggag
aagcccgccgccatccagagcctggatctgatcgtcgccgaggccgatgccatcatggtg
gcgcgcggcgacctgggcgtggagatgccggccgagcaggtgccctcgctgcagaagcag
atcgtccgcgcatgccgcaaggccggcaagccggtcatcgttgccacgcaaatgctcgaa
tcgatgattgccgccccggtgcccacccgcgcggaagcgtcagacgtggcgacggcgatc
tacgacggtgccgacgcggtcatgctgtcggccgagtcggcttcgggccggtatccggtg
gaggcggtgcgaatgatgaacagcattatctcccgcacggaatccgacccgctgtaccgc
gacgccatcgaggcatcccacacgccgccgcgcgcggacgcggctgatgccatcggttat
gcggtgcggcatatcgtgggcttgctcagggtgccggcgacggtcgcctataccagctcg
ggctattcggcgctgcgtatggcgcgcgagcggccgcaggtgcccattctcggcatgaca
ccgcgcatggcgacggcgaggcggctgacgctcacctggggcgtgcatgcggtgctctgc
cacgaggtgctggatgtgccggagatgaccgatctggccagccgcactgtgctggcggag
ggcttcggggaagccggacagtccgtcgtcatctccgcggggctgccgttcctggtggcg
ggaaccaccaacctgctgcggattgcgcagatccaatga

DBGET integrated database retrieval system