KEGG   Ralstonia eutropha H16: H16_B0961Help
Entry
H16_B0961         CDS       T00416                                 

Gene name
pyk3
Definition
(RefSeq) pyruvate kinase (EC:2.7.1.40)
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
reh  Ralstonia eutropha H16
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H16_B0961 (pyk3)
   01230 Biosynthesis of amino acids
    H16_B0961 (pyk3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_B0961 (pyk3)
   00620 Pyruvate metabolism
    H16_B0961 (pyk3)
  Nucleotide metabolism
   00230 Purine metabolism
    H16_B0961 (pyk3)
Enzymes [BR:reh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     H16_B0961 (pyk3)
Exosome [BR:reh04147]
 Exosomal proteins
  Proteins found in most exosomes
   H16_B0961 (pyk3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
2:1082768..1084186
Genome map
AA seq 472 aa AA seqDB search
MRRLRNAKIVATLGPASSTPELIDALFEAGADVFRLNFSHGTHEDHRQRFEAIRAVERKR
GRPIGVLLDLQGPKLRIGTFADGPVQLAAGAGFRLDLDSAAPGSASRVCLPHPEIFAALS
EGVELLLDDGKIRLRVEQCGAGFAETTVVNGGTLSDRKGVNVPDAVLPLSAMTEKDRRDL
DFGLALGADWIALSFVQRPEDIREIKAIVNGRAGIVAKLEKPAAIQSLDLIVAEADAIMV
ARGDLGVEMPAEQVPSLQKQIVRACRKAGKPVIVATQMLESMIAAPVPTRAEASDVATAI
YDGADAVMLSAESASGRYPVEAVRMMNSIISRTESDPLYRDAIEASHTPPRADAADAIGY
AVRHIVGLLRVPATVAYTSSGYSALRMARERPQVPILGMTPRMATARRLTLTWGVHAVLC
HEVLDVPEMTDLASRTVLAEGFGEAGQSVVISAGLPFLVAGTTNLLRIAQIQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagacgccttcgcaacgccaagatcgtggccacgctgggccccgcgagtagcaccccc
gagctcatcgacgcgctgttcgaggccggtgccgatgtcttccggctcaacttcagccac
ggcacccacgaagaccaccggcaacggttcgaagcgatccgcgccgtggagcgcaagcga
ggccgccccatcggtgtgctgctcgacctgcagggtccgaagctgcgcatcggcaccttc
gccgacgggccagtgcaactggccgcgggagccggcttccggctggacctggacagcgcg
gcgcccggctcggccagcagggtctgcctgccgcacccggagatcttcgccgcgctgagc
gaaggcgtcgagctgctgctggacgacggcaagatccggttgcgcgtcgagcagtgcggc
gccggcttcgccgagaccacggtcgtcaacggcggtacgctctcggaccgaaaaggggtg
aacgtgcctgatgcggtgctgccgctgtcggccatgaccgaaaaagaccggcgcgacctc
gacttcggtctggccctgggggcggactggatcgcgctgtccttcgtgcagcggcccgaa
gacatccgggagatcaaggcaattgtcaacggccgcgccggcatcgtggccaagctggag
aagcccgccgccatccagagcctggatctgatcgtcgccgaggccgatgccatcatggtg
gcgcgcggcgacctgggcgtggagatgccggccgagcaggtgccctcgctgcagaagcag
atcgtccgcgcatgccgcaaggccggcaagccggtcatcgttgccacgcaaatgctcgaa
tcgatgattgccgccccggtgcccacccgcgcggaagcgtcagacgtggcgacggcgatc
tacgacggtgccgacgcggtcatgctgtcggccgagtcggcttcgggccggtatccggtg
gaggcggtgcgaatgatgaacagcattatctcccgcacggaatccgacccgctgtaccgc
gacgccatcgaggcatcccacacgccgccgcgcgcggacgcggctgatgccatcggttat
gcggtgcggcatatcgtgggcttgctcagggtgccggcgacggtcgcctataccagctcg
ggctattcggcgctgcgtatggcgcgcgagcggccgcaggtgcccattctcggcatgaca
ccgcgcatggcgacggcgaggcggctgacgctcacctggggcgtgcatgcggtgctctgc
cacgaggtgctggatgtgccggagatgaccgatctggccagccgcactgtgctggcggag
ggcttcggggaagccggacagtccgtcgtcatctccgcggggctgccgttcctggtggcg
ggaaccaccaacctgctgcggattgcgcagatccaatga

DBGET integrated database retrieval system