KEGG   Ralstonia eutropha H16: H16_B2100Help
Entry
H16_B2100         CDS       T00416                                 

Gene name
h16_B2100
Definition
(GenBank) two domain protein: Acyl-CoA synthetase (AMP-forming) and acytransferase
Organism
reh  Ralstonia eutropha H16
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:2369006..2371852
Genome map
AA seq 948 aa AA seqDB search
MKADSPPRQNYEDALLGIVREMSSAMRPPAESEVTVALDSTLEGDLGFDSLTRAELLTRL
EHRFGVSLPEQVLAQADTPRALLRALLAAQDLPPGASGTHLRQARPAPAAQAPDSAATLP
DVLRWHLRSHPERTHIILQDGDGADTQISFAQLHRGAAAIAAGLVSRGVSAGTAVAIMLP
TSPEYFYSFCGVLLAGGIPVPLYPPARLAQIGDHLQRHAGILANAQAPVLITVAQARPLA
ALLKASTGTLHSVLTPQELADGGGAPVHPMLRTHDIALLQYTSGSTGSPKGVVLSHANLL
ANLRAMGKTLAVGSQDVFVSWLPLYHDMGLIGAWLGSLYYAYPLVVMSPLAFLARPERWL
WAIHKYRGTLSGGPNFAFELCLRKLANADLAGLDLSSWRFVFNGAEPVSLQTMRVFMERF
ARYGLRPQAAAPVYGLAEASLGLAFPPLGRGLAADRIDRDKFTRTAVAVPAGEHGPTGER
ETLEFPSCGRPLSGHEVRIVDATGRELGERHEGLLQFRGPSATSGYFRNPVQTRQLFDRG
WLNTGDYAYIAADEVYITGRAKETIVRGGRNIYPYELEQAVGAIPGIRKGCVAVFGSPDP
DSGTERIVVMAETAEKDVQARRALHRQALKTALDVLGMPPDHIALVPPHSILKTSSGKIR
RAACRERFEHGRPGRGVEAPWLQIARFGWRALRPELRRGRQTAASLSYALYTWLLFATLA
PATWLASVALHRPALGWTLSHHAARLFLRLGAVPWFVQGLEHLPRNRPCILVSNHASYLD
GIVLVAALPTPVCMVAKRELQRQRIPGTYLASIGADFIDRFDNVREHEDVERVVAAVRAG
HSALFFPEGTFGRAPGLQAFRSGAFLAAARAGAPVVPVAIRGTRSVLRDGQWLPRRGPIG
VVIGSPLWPDGADWPAAMRLRNTARAEILHYCGEPDARRTTHRDARRA
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggattctcccccgaggcagaactacgaagatgccctgctcggcatcgtgcgg
gagatgtcttcggccatgcgcccgccggcagagtccgaagtgacggtcgcgctggacagc
acgctcgaaggcgacctgggcttcgacagcctcacgcgcgccgagctgctgacccgcctt
gaacaccgcttcggcgtcagcctgccggagcaggtgctggcccaggccgacaccccgcgc
gcgctgctgcgcgccttgctcgccgcccaggacctgccgcccggagcgagcggcacgcac
ctgcgccaggcccgccctgccccggcggcacaggcgcccgacagtgccgccaccttgccg
gacgtgctgcgctggcacttgcgcagccacccggagcgcacccacatcatcctgcaggac
ggcgacggcgcagacacgcagatcagctttgcccagctgcaccgcggcgctgcggccatc
gcggccgggctggtgtcccgcggcgtgagcgcgggcacggccgtggccatcatgctgccc
accagccccgaatacttctacagcttctgcggcgtgctgctggcgggcgggattccggtg
ccgctctacccgccggcgcggctggcgcagatcggcgaccacctgcagcgccacgccggc
atcctggccaacgcgcaggcgccggtcctgatcacggtggcacaggcgcggccgctggcg
gccctgctcaaggccagcacgggaacgctgcatagcgtgctcacgccgcaggagctggcg
gacggcggcggcgccccggtccatccgatgctgcgcacgcacgacatcgccctgctgcaa
tacacctcaggcagcaccggctcgcccaagggggtcgtgctcagccatgccaacctgctg
gccaacctgcgcgccatgggcaagaccctggccgtcggctcgcaggacgtctttgtcagc
tggctgccgctctatcacgacatgggcctgatcggcgcctggctgggcagcctgtactac
gcctacccgctggtggtgatgtcgccgcttgccttcctggcgcggcccgagcgctggctc
tgggcgatccacaagtaccgcggcacgctctcgggcgggcccaacttcgccttcgaactg
tgcctgcgcaagctggccaatgccgacctggccgggctggacctgtccagctggcgcttc
gtcttcaatggcgcggagccggtgagcctgcagaccatgcgcgtcttcatggagcgcttt
gcccgctacggcctgcgcccgcaggctgccgcgccggtgtacgggctggcggaggcctcg
ctgggcctggcctttccgccgcttggccgagggctggcggccgaccgcatcgaccgcgac
aaattcacgcgtactgccgtggccgtgcccgcgggcgaacacgggcccactggcgagcgc
gagacactggaattcccgtcctgcggccggccgctgtccggccacgaagtccgcatcgtc
gacgccaccggacgcgaactgggcgagcggcatgaaggcctgctgcagttccgcggccct
tcagccaccagcggctatttccgcaatcccgtgcagacccgccagctgttcgaccgcggc
tggctgaacaccggcgactatgcctatatcgccgccgatgaggtctatatcaccgggcgc
gccaaggaaaccatcgttcgcggcggccgcaatatctatccctatgaactggagcaggcg
gtcggcgccatccccggcatacgcaagggctgcgtggccgtgttcggcagtcccgatccg
gatagcggcacggaacgcatcgtggtgatggcggaaaccgcagagaaggatgtgcaggcg
cgccgcgcgctgcaccggcaggcgctgaagaccgccctcgacgtgctgggcatgccgccc
gaccatatcgcgctggtgccgccgcacagcatcctgaagacatcgagcggcaagatccgg
cgcgccgcctgccgcgagcgcttcgagcacggacgccccggccgcggcgtggaagcgccc
tggctgcagatcgcgcgctttggctggcgcgcgctgcggccggaactgcggcgcggccgg
cagaccgccgcgagcctgtcctacgcgctctacacctggctcctgttcgcaacgctggcg
ccggcgacctggctggcatcggttgcgctgcaccggccggcactgggctggacgctcagc
caccacgccgcccggctgtttctcaggctgggcgcggtgccctggttcgtgcaagggctt
gagcacctgccgcgcaaccggccctgcatcctggtctcgaaccacgccagctacctggac
ggcatcgtgctggtggccgcgctgcccacgccggtatgcatggtcgccaagcgcgagctg
cagcgccagcgcattcccggcacctacctggccagcatcggcgcggacttcatcgaccgc
ttcgataacgtgcgcgagcacgaggatgtggagcgcgtggtggccgcggtgcgcgccggg
cattcggcgctgttcttccccgaaggcaccttcggccgtgcgccggggctgcaggccttc
cgctcgggcgctttcctggcggccgcgcgggccggcgcgcctgtggtgccggtcgccatc
cgcggcacccgctcggtgctgcgcgacggccagtggctgccgcgccgcgggccaatcggc
gtggtcatcggcagcccgctctggccggacggcgcagactggcccgccgccatgcgcctg
cgcaacaccgcccgcgccgagatcctccattactgcggcgaaccggatgcgcggcgcacg
acgcaccgggatgcgaggcgggcctag

DBGET integrated database retrieval system