KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH01409Help
Entry
REMIM1_CH01409    CDS       T02778                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase (Cu-Zn)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Brite
Enzymes [BR:rel01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     REMIM1_CH01409 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AGS21241
UniProt: S5S1N3
LinkDB All DBs
Position
1433064..1433579
Genome map
AA seq 171 aa AA seqDB search
MKAIHILAALSLLALALPASAQDKQTAVANFVGKDGKENGRAQLTAAANGGVLIEVEISE
LPANKWVAFHVHETGRCDAATHYESAGGHFNPNSAEHGILAAKGPHAGDMPNQYVGQDGV
LRAQIFDGMVTLDGKKDGIRGRALMVHANSDDYRSQPSGDAGERLACGVVQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccattcacatcctcgccgccctgagcctgctggcccttgccttgccggcaagc
gcccaggacaagcagacggcggtcgccaatttcgtcggcaaggacggcaaggaaaacggt
cgggcccaattgacggctgccgccaatggcggcgtcctgatcgaagtggagatatcggag
ttgccggccaataaatgggtggcctttcatgttcatgaaaccggccgctgtgacgcggcg
acccattacgagtcggcaggtggccatttcaacccgaactcggccgagcatggcatcctt
gccgccaaggggccgcatgctggcgacatgcccaaccagtatgttggacaggacggtgtg
ctcagagcccagatcttcgatggcatggtcacgctcgacggaaagaaagatggcattcgc
ggccgcgcattgatggtgcacgccaattcggatgattatcgcagccagccttccggtgac
gccggggagagacttgcctgcggagtggtccaatag

DBGET integrated database retrieval system