KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH01444Help
Entry
REMIM1_CH01444    CDS       T02778                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    REMIM1_CH01444 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    REMIM1_CH01444 (alr)
Enzymes [BR:rel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     REMIM1_CH01444 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:rel01011]
 Precursor biosynthesis
  Racemase
   REMIM1_CH01444 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1462846..1464009)
Genome map
AA seq 387 aa AA seqDB search
MTDFPIPSEDDELFNSAGLRLTVDLSALTENWRDMARRSGAARAAAVVKADAYGMGIEDA
GEALYLAGARDFFVATVDEGVTLRLYAPEARIFVLSGIWPGTERRFFDNDLVPVISSDEQ
FAFWMAVLADYGDYPCALHVDTGFNRLGLHIDDAIALADDVSRPASFAPVLVMSHLACGD
DPSHLMNRQQLESFRKVTAAYEGIDSSLAASAGIFLGEDYHFDLTRPGIALYGGEAVCGV
TNPMRPVATTEARIIQVRTVKAGETVSYGRALQLHRDSRLAIVSAGYADGYMRSQSSGGV
PLRQAVPQGGQGFIAGHKVPVAGRITMDLTIFDVTDLPENAVRAGDYVELFGKNMALDDV
ARAAGTIGYEILTSMGLRHERRYVAEE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacagattttcctatcccctccgaagacgatgagcttttcaattccgcaggactgcgg
ctgaccgtcgacctgagtgcgctcacggagaactggcgcgacatggcgcgccgctctggt
gcagcgcgcgccgcagccgtcgtcaaggcggacgcctacggcatgggcatcgaggatgcc
ggcgaagcgctctacctcgcaggcgcccgggatttcttcgtcgcgaccgtcgatgagggc
gtcacccttcgcctctatgcgcccgaggcgcgcatcttcgtgctctcgggcatatggccg
ggcacggaaaggcggttcttcgacaatgatctggtgccggtgatttcctccgacgagcag
ttcgccttctggatggcggtgcttgccgattatggcgattatccctgcgcgctgcatgtc
gataccggcttcaatcggctggggctgcacatcgacgacgccatcgcccttgccgacgac
gtctcgcggccggcaagcttcgcgccggtgctggtcatgagccatctcgcctgcggcgac
gatcccagccatcttatgaaccggcaacagctcgaatcattccgcaaggttacggccgcc
tatgaaggtatcgattcaagtctagccgcctcggccggcatctttctcggcgaggattat
catttcgacctgacccgtcccggcatcgcgctttacggcggcgaagcggtctgcggcgtg
acaaatccgatgcggccagtggcaacgacggaagcgcgcatcattcaggtgcgcaccgtc
aaggccggcgagacggtcagttacgggcgggcgctgcagcttcaccgcgacagccggctg
gcgatcgtctcggcgggttatgctgacggctatatgcgcagccaatcgagcggcggcgtg
ccgctgcgtcaggccgtgccgcaaggcgggcaaggcttcatcgccggacacaaagtgcca
gtcgccggccggatcaccatggacctgactattttcgacgtcaccgatctgccggaaaac
gccgtgcgcgccggcgactatgtcgagctgttcggtaagaacatggcgcttgatgacgtc
gcgcgagcggcggggacgatcggatacgagatcctgaccagcatggggctgcgccacgag
cggcgctacgtcgccgaagaataa

DBGET integrated database retrieval system