KEGG   Rhodococcus equi: REQ_36910Help
Entry
REQ_36910         CDS       T01352                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
req  Rhodococcus equi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3941869..3943365)
Genome map
AA seq 498 aa AA seqDB search
MTGLINANETSPKLQHPGRLFIGGRWVEPNTAATFDVVNPATEEVFLTVAEADAQDMAQA
VDAARDAFDRGPWPRMTHAERATYLRAIGAGIRERSAELGAIWTSEMGILAAVSSYASAG
SGDVFDYYAGLADTYEWVEDHRPSSGQGVGLLVREPVGVVAAIIPWNSPLGLLANKVAPA
LLAGCTVVVKASPEAPGAVYAFAEIAEAAGLPAGVVNVVTADREVSELLVRNPGIDKVAF
TGSTAAGRRIASLCGERIARCTLELGGKSAGVILDDYDLATAAQSIATSARIMTGQVCAS
LTRIVVSRHRHDEFVDALGAAMSAIRVGDPFDAETEMGPLAMSRQLEKVEGLIAKGCEEG
ATLVTGGRRPAHLERGFFIEPTVFGNVDNDSTIAREEVFGPVVSVIAADDENHAVDIAND
TVYGLNASVFTDDIERAWTVSRQLRSGTVGHNSFKTDFGIAFGGFKQSGMGREGGLEGLQ
PYLEAKTVLLDAMPPSLT
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtctgatcaacgcgaacgagacgtcaccgaagttgcagcaccccggccggttg
ttcatcggcggacgctgggtggagccgaacacggcggccaccttcgacgtcgtcaatccg
gcaaccgaggaggtcttcctcaccgtcgcggaggccgacgcgcaggacatggcccaggcc
gtcgacgccgcccgtgacgccttcgaccggggcccgtggccgcggatgacccacgccgag
cgcgccacctacctgcgggcgatcggcgccggcatccgtgagcgcagcgccgaactcggg
gcgatctggaccagcgagatgggcatcctcgccgccgtctcctcgtacgcctccgccggc
tccggcgacgtcttcgactactacgcggggctcgccgacacctacgagtgggtcgaggac
caccggccgagctcgggtcagggcgttggcctgctcgttcgtgaaccggtcggcgtcgtc
gccgcgatcatcccgtggaacagccccctcggcctgctcgccaacaaggtcgctcccgcg
ctcctcgcgggctgcaccgtcgtcgtcaaggcgtcccccgaggcacccggcgcggtctat
gcgttcgccgagatcgccgaggcggcggggctgcccgccggcgtcgtcaacgtcgtcacg
gccgaccgcgaggtgtcggaactgctcgtccgtaaccccggcatcgacaaggtcgccttc
accgggtccaccgccgccggtcgccggatcgcctccctgtgcggcgaacggatcgcgcgc
tgcacgctcgaactcggcggcaagtccgcgggcgtcatcctcgacgactacgacctcgcc
accgctgcccagtccatcgcgacgtcggcgcggatcatgaccggccaggtgtgcgcgtcg
ctgacccgcatcgtcgtcagccgtcaccgccacgacgagttcgtcgacgccctcggcgcc
gcgatgtccgcgatccgcgtcggcgatccgttcgacgccgagaccgagatgggtccgctc
gcgatgtcccgtcagctcgagaaggtcgaaggactgatcgccaagggatgcgaggagggc
gccacgctcgtcaccggtggccgtcggcccgctcacctcgagcgcggcttcttcatcgaa
cccacggtcttcggcaacgtcgacaacgactcgaccatcgcgcgcgaggaggttttcggt
cccgtcgtgagcgtcatcgcggccgacgacgagaaccacgcggtcgacatcgcgaacgac
accgtctacggcctgaacgcatccgtgttcacagacgacatcgaacgtgcatggacggtg
tcgcggcagctgcgttccggcaccgtggggcacaacagcttcaagaccgacttcgggatc
gccttcggcggcttcaagcagtccggaatggggcgcgagggcggtctcgagggcctgcag
ccgtacctggaggcgaagaccgtcctgctcgacgcgatgccgccgagcctgacctga

DBGET integrated database retrieval system