KEGG   Rhizobium etli CFN 42: RHE_CH01147Help
Entry
RHE_CH01147       CDS       T00317                                 

Gene name
gstch6
Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RHE_CH01147 (gstch6)
Enzymes [BR:ret01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RHE_CH01147 (gstch6)
Transporters [BR:ret02000]
 Other Transporters
  Pores ion channels [TC:1]
   RHE_CH01147 (gstch6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABC89954
RhizoBase: RHE_CH01147
UniProt: Q2KB32
LinkDB All DBs
Position
1199843..1200463
Genome map
AA seq 206 aa AA seqDB search
MLTLYYASGTCALASLIALEESGLAFETKKLSFANSEQRSPDYLKINPKGRVPALVTDRG
VLTETPAILGFIADSAPTAKLAPLGDAFEMARLQSFNSYLCSTVHVNHAHRRRGSRWTDD
PAAIEAMKAKVPQNMADCFTLIEETMFDAPWVMGETYSLADPYLFVMTDWLPADGVDPAR
FAKVSDHHARMLQRPAVQRALAFDRG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgacattatattacgcgtccggaacctgcgcgcttgcaagcctcattgccctggag
gaatccggcctggccttcgaaacgaagaagctcagcttcgccaatagcgagcagcgttcg
ccggactatctgaagatcaatccgaagggccgggtgccggcgctcgtcacggatcgcggc
gtgctgacggaaacaccggcgatcctcggcttcatcgctgatagcgccccgaccgcaaag
ctcgcgccgctcggcgatgccttcgaaatggcgcggctgcaatccttcaacagctatctc
tgctcgaccgtgcatgtgaaccatgcccatcgccggcgcggctcgcgctggaccgacgat
ccggcggcaatcgaggcgatgaaggccaaggtaccgcagaatatggccgattgtttcacg
ctgatcgaagagacgatgttcgacgccccctgggtgatgggcgagacctattcgctcgcc
gatccctatctcttcgtcatgaccgactggctgcccgccgacggcgtcgatcccgcccgc
tttgcaaaagtcagcgaccaccacgcccgcatgctgcagcgccccgccgttcagcgggcg
ctggccttcgaccggggctaa

DBGET integrated database retrieval system