KEGG   Rhodococcus erythropolis CCM2595: O5Y_08460Help
Entry
O5Y_08460         CDS       T02806                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
rey  Rhodococcus erythropolis CCM2595
Brite
Translation factors [BR:rey03012]
 Eukaryotic Type
  Elongation factors
   O5Y_08460
 Prokaryotic Type
   O5Y_08460
Mitochondrial biogenesis [BR:rey03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    O5Y_08460
Exosome [BR:rey04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   O5Y_08460
  Exosomal proteins of breast cancer cells
   O5Y_08460
  Exosomal proteins of colorectal cancer cells
   O5Y_08460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1801429..1802619
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAFPDLNEASAFDQIDKAPEEKA
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKADMVDDDEILELVEMEVRELLAAQEFDEEAPVIPISALKAL
EGDPKWTQSILDLMAAVDESIPDPVRETDKPFLMPVEDVFTITGRGTVVTGRIERGSVNV
NEEVEIVGIKETSTKTTVTGIEMFRKLLDSGQAGDNVGLLVRGIKREDVERGQVVVKPGT
TTPHTEFEGQAYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNTE
MSVKLIQPVAMDEGLRFAIREGGRTVGAGKVAKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggcgaagttcgagcggacgaagccgcacgtgaacatcggcaccattggtcac
gtcgaccacggcaagaccacgacgacggcggccatcaccaaggttctcgcggatgcattc
cccgacctgaacgaggcttcggccttcgatcagatcgacaaggctcccgaggaaaaggct
cgtggcatcacgatcaacatctcgcatgttgagtaccagacggaaaagcgccactacgcg
cacgtcgatgcaccgggtcacgccgactacatcaagaacatgatcaccggcgcagctcag
atggacggcgctatcctcgtcgtcgcagctaccgacggcccgatgccccagacgcgcgag
catgtcctgctcgctcgccaggttggcgttccttacatcctcgtcgccctgaacaaggcc
gacatggttgacgatgacgagatcctcgagctcgtcgagatggaggtccgcgaactgctg
gccgctcaggaattcgacgaggaagcccccgtcattccgatctcggcactcaaggcactc
gagggtgacccgaagtggacgcagtccatcctcgacctgatggctgcagtcgacgagtcc
atcccggacccggtccgcgagacggacaagcccttcctcatgcccgtcgaggatgtcttc
acgatcaccggccgtggcacggttgtcaccggtcgtatcgagcgtggctcggtcaacgtg
aacgaggaggtggagatcgtcggcatcaaggagacctccaccaagaccaccgtcacgggt
atcgagatgttccgcaagctgctcgactcgggccaggccggcgacaacgtcggactgctc
gttcgtggcatcaagcgcgaagatgtcgagcgtggacaggttgtcgtcaagccgggcacc
acgactccccacacggagttcgagggccaggcatacatcctgtcgaaggacgagggcggc
cgccacaccccgttcttcaacaactaccgcccgcagttctacttccgtaccacggacgtt
acgggcgtcgtgacgctgcctgagggcaccgagatggtcatgcccggtgacaacaccgag
atgtccgtcaagctcatccagcctgtcgccatggacgagggcctgcgcttcgcaattcgc
gaaggcggccgtacggtcggcgccggcaaggttgccaagatcatcaagtga

DBGET integrated database retrieval system